SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g38570

Feature Type:gene_model
Chromosome:Gm20
Start:46131896
stop:46134314
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g38570
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G55120AT Annotation by Michelle Graham. TAIR10: Chalcone-flavanone isomerase family protein | chr3:20430248-20431415 REVERSE LENGTH=246 SoyBaseE_val: 2.00E-67ISS
GO:0009411GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV SoyBaseN/AISS
GO:0009718GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0042398GO-bp Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009705GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane SoyBaseN/AISS
GO:0042406GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to endoplasmic reticulum membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016872GO-mf Annotation by Michelle Graham. GO Molecular Function: intramolecular lyase activity SoyBaseN/AISS
GO:0045430GO-mf Annotation by Michelle Graham. GO Molecular Function: chalcone isomerase activity SoyBaseN/AISS
PF02431PFAM Chalcone-flavanone isomerase JGI ISS
UniRef100_Q53B75UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chalcone--flavonone isomerase 1B-1 n=2 Tax=Glycine max RepID=CF1B1_SOYBN SoyBaseE_val: 3.00E-164ISS
UniRef100_Q53B75UniRef Annotation by Michelle Graham. Best UniRef hit: Chalcone--flavonone isomerase 1B-1 n=2 Tax=Glycine max RepID=CF1B1_SOYBN SoyBaseE_val: 3.00E-164ISS

Expression Patterns of Glyma20g38570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g38570
ParalogEvidenceComments
Glyma10g43850 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g38570 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g241600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g38570
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g38570
>Glyma20g38570.1   sequence type=CDS   gene model=Glyma20g38570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACACCAGCATCCATCACTAATGTCACTGTGGAGTTCCTTCAATTCCCCGCACTGGTGACACCTCCTGGCTCTACCAAATCCTATTTCCTTGGCGGCGCAGGGGTGAGAGGGTTGAATATTCAAGAAGAATTTGTGAAGTTCACGGGAATAGGTGTTTATTTGGAAGACAAGGCCGTGTCATCACTCGCTGCCAAATGGAAGGGCAAGAGTGCAGCTGAATTGCTCGACTCCCTTGACTTCTACAGAGATATCATCAAAGGCCCCTTTGAGAAGTTAATTCGAGGGTCAAAGTTAAGAACATTGGATGGTCGTGAATACGTAAGGAAGGTATCAGAGAACTGTGTGGCACATATGCAATCTGTTGGGACTTACAGTGATGAGGAGGAAAAAGCTATTGAGGAATTTAGAAATGCTTTCAAGGATCAAAATTTCCCACCAGGCTCCACTGTTTTCTACAAACAATCACCCACTGGAACATTGGGGCTTAGTTTCTCGAAAGATGAGACAATACCAGAACATGAGCATGCAGTGATAGACAACAAGCCACTTTCGGAGGCAGTGCTGGAGACTATGATCGGAGAGATTCCTGTTTCCCCTGCTTTGAAAGAGAGTTTGGCTACAAGGTTTCATCAGTTCTTCAAAGAGTTAGAGGCCAATCCCAACATTGAAAACTGA
Predicted protein sequences of Glyma20g38570
>Glyma20g38570.1   sequence type=predicted peptide   gene model=Glyma20g38570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATPASITNVTVEFLQFPALVTPPGSTKSYFLGGAGVRGLNIQEEFVKFTGIGVYLEDKAVSSLAAKWKGKSAAELLDSLDFYRDIIKGPFEKLIRGSKLRTLDGREYVRKVSENCVAHMQSVGTYSDEEEKAIEEFRNAFKDQNFPPGSTVFYKQSPTGTLGLSFSKDETIPEHEHAVIDNKPLSEAVLETMIGEIPVSPALKESLATRFHQFFKELEANPNIEN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo