SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g37861): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g37861): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g37861

Feature Type:gene_model
Chromosome:Gm20
Start:45616974
stop:45619982
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G27620AT Annotation by Michelle Graham. TAIR10: cyclin H;1 | chr5:9771762-9774684 FORWARD LENGTH=336 SoyBaseE_val: 2.00E-86ISS
GO:0000079GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cyclin-dependent protein kinase activity SoyBaseN/AISS
GO:0000278GO-bp Annotation by Michelle Graham. GO Biological Process: mitotic cell cycle SoyBaseN/AISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006366GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0010440GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal lineage progression SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0045736GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of cyclin-dependent protein kinase activity SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005675GO-cc Annotation by Michelle Graham. GO Cellular Compartment: holo TFIIH complex SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016591GO-cc Annotation by Michelle Graham. GO Cellular Compartment: DNA-directed RNA polymerase II, holoenzyme SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004693GO-mf Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0019901GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase binding SoyBaseN/AISS
PTHR10026Panther CYCLIN JGI ISS
PTHR10026:SF8Panther CYCLIN H JGI ISS
UniRef100_B9RF84UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cyclin h, putative n=1 Tax=Ricinus communis RepID=B9RF84_RICCO SoyBaseE_val: 3.00E-99ISS
UniRef100_UPI000233DDFDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DDFD related cluster n=1 Tax=unknown RepID=UPI000233DDFD SoyBaseE_val: 7.00E-137ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g37861 not represented in the dataset

Glyma20g37861 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g234800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g37861.1   sequence type=CDS   gene model=Glyma20g37861   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCGTCGTGTACATTGTCTCTGGAACATCAACCAAAACACATTATGTTGACCTGCATATATGCTGCCTGTAAAATAGAAGAAAATCATGTGTCAGCTGAGGAGCTTGGTAAGGGGATATCACAGGATCATCAAATGATTCTCAATAATGCAGATGATAAAACCCTTGTTTTGCAGAGTTTGGAATTTGATCTTATTGTGTATGCACCATATCGCTCAGTTGAAGGTTTTATAAATGATATGGAGGAATTCTTTAATGCTGGTGATAACCAGCTTGAAATGCTCAAGACTTTGCAAGAGACAGCAAGATTTGAAGTTGATAAAATGATGCTTACAGATGCACCACTTTTATTTCCTCCTGGGCAGTTGGCCTTGGCTGCTTTAGGCAACTCAAATGCACTCCACAGAGTCATTGACTTTGATAGTTATCTTAGGGGTATTTTTTCCCGTGAGAATTCCATGCATACAATGTCCGAGCTTTCTGAATCACTGGATGCAATTGATTCTTGGGTAATTGAATTGAAGCATATCAACCGAAAACTAAAGTCTTGTTGGGGTCATCACTCTCATGACGAGGGCAAGAAGCGGGAGAAGAAATCAAAGCACAAGTCCAAAAAGAGCTCAAATGAAGCTCAAAATATGCCATCTATTGCCTAG

>Glyma20g37861.1   sequence type=predicted peptide   gene model=Glyma20g37861   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SSCTLSLEHQPKHIMLTCIYAACKIEENHVSAEELGKGISQDHQMILNNADDKTLVLQSLEFDLIVYAPYRSVEGFINDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALGNSNALHRVIDFDSYLRGIFSRENSMHTMSELSESLDAIDSWVIELKHINRKLKSCWGHHSHDEGKKREKKSKHKSKKSSNEAQNMPSIA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo