Glyma20g36580 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g36580

Feature Type:	gene_model
Chromosome:	Gm20
Start:	44644310
stop:	44646041
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g36580

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G07090	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF640) \| chr1:2174202-2174792 REVERSE LENGTH=196	SoyBase	E_val: 8.00E-78	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF04852	PFAM	Protein of unknown function (DUF640)	JGI		ISS
UniRef100_D7M6V0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Light-dependent short hypocotyls 1 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7M6V0_ARALL	SoyBase	E_val: 7.00E-72	ISS
UniRef100_I1NIN1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NIN1_SOYBN	SoyBase	E_val: 2.00E-123	ISS

Expression Patterns of Glyma20g36580

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g36580

Paralog	Evidence	Comments
Glyma10g30890	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g36580 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g223100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g36580

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g36580

Limit To All Plant Sequences

>Glyma20g36580.1   sequence type=CDS   gene model=Glyma20g36580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTGGTTTCGGAATCAACAAACGCTGTTTCAAACCCCAGCAGCAGGTACAAGATGGAGACGCCAACCACGAATCCAACGACGGCGGCGGTGTCGTCTCCGTCTTCGGGAAGCAACAATAGCGGGAGCACTACTACTCCGAGCCGCTACGAGAACCAAAAGCGAAGGGACTGGAACACCTTCTGCCAGTACTTGAGGAACCACCGTCCCCCACTCTCCTTGTCCCTTTGCAGCGGCGCGCACGTGCTGGAATTCCTCCACTACCTCGACCAGTTCGGGAAGACTAAGGTTCACAACCACCCATGCCCGTTCTTCGGTCTCCCCAACCCACCTGCCCCGTGTCCCTGCCCGCTCCGACAGGCCTGGGGCAGCCTCGACGCCCTCATCGGCCGCCTCCGCGCGGCCTACGAGGAGAACGGCGGCCGCCCGGAGACCAATCCATTCGGCGCACGCGCCGTCAGGACTTACCTGCGCGATGTTCGCGATTTTCAGGCAAAGGCGAGAGGTGTTAGCTATGAGAAGAAGAGGAAGAGGCCAAAGCCCAAGGTCACTCATCCCACTCCTACTTAA

Predicted protein sequences of Glyma20g36580

Limit To All Plant Sequences

>Glyma20g36580.1   sequence type=predicted peptide   gene model=Glyma20g36580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLVSESTNAVSNPSSRYKMETPTTNPTTAAVSSPSSGSNNSGSTTTPSRYENQKRRDWNTFCQYLRNHRPPLSLSLCSGAHVLEFLHYLDQFGKTKVHNHPCPFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGRPETNPFGARAVRTYLRDVRDFQAKARGVSYEKKRKRPKPKVTHPTPT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain