SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g36390): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g36390): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g36390

Feature Type:gene_model
Chromosome:Gm20
Start:44517400
stop:44518694
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G64780AT Annotation by Michelle Graham. TAIR10: ammonium transporter 1;2 | chr1:24061021-24062565 REVERSE LENGTH=514 SoyBaseE_val: 4.00E-176ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0010264GO-bp Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process SoyBaseN/AISS
GO:0015695GO-bp Annotation by Michelle Graham. GO Biological Process: organic cation transport SoyBaseN/AISS
GO:0015696GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transport SoyBaseN/AISS
GO:0015843GO-bp Annotation by Michelle Graham. GO Biological Process: methylammonium transport SoyBaseN/AISS
GO:0072488GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008519GO-mf Annotation by Michelle Graham. GO Molecular Function: ammonium transmembrane transporter activity SoyBaseN/AISS
PTHR11730Panther AMMONIUM TRANSPORTER JGI ISS
PTHR11730:SF8Panther AMMONIUM TRANSPORTER 1 JGI ISS
PF00909PFAM Ammonium Transporter Family JGI ISS
UniRef100_G7I667UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ammonium transporter n=2 Tax=Medicago truncatula RepID=G7I667_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1NIL3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NIL3_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g36390 not represented in the dataset

Glyma20g36390 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g31080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g221400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g36390.1   sequence type=CDS   gene model=Glyma20g36390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGCGCAATGACTTCCAATTCCCATCATACTCTTCTCTCTCTTGCTCCGCCAACCACCTTGCACCCCTCTTCAACGACACCGCCGCCGCAAACTACCTCTGCGCCCAATTCGATTCCATTTCCAAGGGCCTCGCCGACACCACCTACTTTCTAGCCAAGAACACCATGAACATCATGCTCACCAAAGTCCTCGACGCCGCCGCCGGCGGCCTCTCTTACTACCTCTTCGGCTTCGCATTCGCCTTCGGCGCCCTCTCCAACGGCTTCATCGGCCGCCACTTCTTCGGCCTCCGAGATTTCCCGATGGGTGCCTCTCCCTCCGGCGACTACAGCTTCTTCCTCTACCAGTGGGCCTTCGCCATCGCCGCCGCCGGAATCACCAGCGGCACCATCGCCGAGAGAACACAGTTCGTGGCTTACCTCATCTACTCTTCTTTCTTAACCGGTTTGGTTTACCCCATCGTTTCGCATTGGTTCTGGTCCTCAGACGGTTGGGCCAGCGCGGCTCGTAGCAACGGAAATGTTTTGTTCGGGTCTGGAGTCATCGACTTTGCGGGCTCAGGCGTTGTTCACATGGTTGGCGGGATAGCGGGCATGTGGGGGGCTTTAATTGAAGGCCCGAGAATCGGCCGGTTCGACCGGACGGACCGGTCCGTGGCTTTGCGTGGCCACAGCGCGTCTTTAGTTGTGCTTGGTTCGTTTTTGTTGTGGTTCGGGTGGTACGGCTTCAACCCTGGTTCGTTTATCACTATAGCGAAGGCACTGCGGTTATTGGTGGGCCATTGGAACGCGATTGACGTGTGTAACGGCCTGCTTGACGGGTTCGCTGCGATTACATCGGGCTGTGCCGTAGTAGAACCGTGGGCCGCGATTGTGTGCGGGTTTGAGGCGGCGTGGGTTTTGATTGGGCTTAATAAGCTTGCCGCGAAGGTGGAGTACGATGATCCACTGGAGGCGGCGCAGCTTCACGGCGGGTGTGGCGCGTGGGGAGTGTTCTTCACGAGATTGTTTGCGAAGAGAGTGTACATGGAGGAGATTTGCGGCGTTGGAAGGCCGTTCGGGGCGTTGATGGGCGGCGCAGGTGATTCAGATATTGGTGGTGTGCGGGTGGGTCACGGCGACCATGGCGGCGTTGTTCAAAAGATGAATCTGTTGAGAATTTCGAGGGATGGTGGGTTTGCATATGCATATGATAGCTGA

>Glyma20g36390.1   sequence type=predicted peptide   gene model=Glyma20g36390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWRNDFQFPSYSSLSCSANHLAPLFNDTAAANYLCAQFDSISKGLADTTYFLAKNTMNIMLTKVLDAAAGGLSYYLFGFAFAFGALSNGFIGRHFFGLRDFPMGASPSGDYSFFLYQWAFAIAAAGITSGTIAERTQFVAYLIYSSFLTGLVYPIVSHWFWSSDGWASAARSNGNVLFGSGVIDFAGSGVVHMVGGIAGMWGALIEGPRIGRFDRTDRSVALRGHSASLVVLGSFLLWFGWYGFNPGSFITIAKALRLLVGHWNAIDVCNGLLDGFAAITSGCAVVEPWAAIVCGFEAAWVLIGLNKLAAKVEYDDPLEAAQLHGGCGAWGVFFTRLFAKRVYMEEICGVGRPFGALMGGAGDSDIGGVRVGHGDHGGVVQKMNLLRISRDGGFAYAYDS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo