Glyma20g36170 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g36170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g36170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g36170

Feature Type:	gene_model
Chromosome:	Gm20
Start:	44380592
stop:	44384520
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g36170

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G65650	AT	Annotation by Michelle Graham. TAIR10: Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 \| chr1:24415172-24417466 REVERSE LENGTH=330	SoyBase	E_val: 0	ISS
GO:0000085	GO-bp	Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0010016	GO-bp	Annotation by Michelle Graham. GO Biological Process: shoot morphogenesis	SoyBase	N/A	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0016571	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone methylation	SoyBase	N/A	ISS
GO:0016579	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein deubiquitination	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0048366	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf development	SoyBase	N/A	ISS
GO:0048367	GO-bp	Annotation by Michelle Graham. GO Biological Process: shoot development	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004221	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin thiolesterase activity	SoyBase	N/A	ISS
GO:0004843	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-specific protease activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008242	GO-mf	Annotation by Michelle Graham. GO Molecular Function: omega peptidase activity	SoyBase	N/A	ISS
KOG2778	KOG	Ubiquitin C-terminal hydrolase	JGI		ISS
PTHR10589	Panther	PROTEASE FAMILY C12 UBIQUITIN CARBOXY-TERMINAL HYDROLASE	JGI		ISS
PTHR10589:SF16	Panther	UBIQUITIN CARBOXYL-TERMINAL HYDROLASE ISOZYME L5	JGI		ISS
PF01088	PFAM	Ubiquitin carboxyl-terminal hydrolase, family 1	JGI		ISS
UniRef100_B9S046	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin carboxyl-terminal hydrolase isozyme L5, putative n=1 Tax=Ricinus communis RepID=B9S046_RICCO	SoyBase	E_val: 0	ISS
UniRef100_I1NIJ5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NIJ5_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma20g36170

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g36170 not represented in the dataset	Glyma20g36170 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g36170

Paralog	Evidence	Comments
Glyma10g31340	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g36170 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g219500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g36170

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g36170

Limit To All Plant Sequences

>Glyma20g36170.1   sequence type=CDS   gene model=Glyma20g36170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTGGTGCACCATTGAGTCCGATCCCGGTGTGTTTACAGAACTCATTCAGCAAATGCAAGTGAAAGGAGTACAGGTTGAGGAACTGTATTCATTGGACCTTGACTCTCTCAACAGCCTTAGGCCTGTTTATGGGTTGATTTTTCTTTTCAAATGGCGTCCAGGAGAAAAGGATGATCGTGTCGTTATCAAAGATCCCAACCCTAACTTGTTTTTTGCTAGTCAGGTAATTAATAATGCTTGTGCTACCCAAGCGATCTTGTCCATTCTTATGAATTCACCAGATATTGATATTGGTCCAGAGCTGACGAAATTGAAAGAATTTACCAAGAATTTCCCTCCTGAGCTCAAAGGTTTAGCCATCAATAACAGTGAGGCCATACGTACAGCCCATAATAGCTTTGCCAGGCCAGAACCTTTTGTTCCTGAAGAGCAAAAGGTTGCTAGCAAAGATGATGATGTTTACCATTTCATAAGCTATCTACCTGTTGATGGGGTACTATATGAGCTTGATGGATTAAAGGAGGGTCCCATCAGCCTTGGTCAGTGCTCTGGTGGGCAAGGTGATATGGAATGGCTGAAGATGGTGCAGCCCGTGATCCAGGAACGCATTGAAAGGTATTCCCAAAGTGAAATAAGATTTAATCTCCTGGCAGTCATCAAGAACAGGAAAGAGATGTATACTGCTGAGCTGAAGGAACTTCAGAAGAGGAGGGAGCGCATTTTGCAGCAGCTAGCAGCATCAAAGTCAGACAGACTTGTGGACAATAGCAGTTTTGAGGCACTGAACAATTCTCTCTCTGAAGTGAATGCTGGGATTGAAGCAGCTACTGAGAAGATCTTGATGGAGGAAGAAAAATTCAAAAAATGGAGAACAGAAAATATTCGGAGGAAACACAACTACATACCCTTTTTGTTTAACTTTCTAAAGATTCTCGCTGAGAAGAAGCAGCTGAAGCCCCTCATTGAGAAGGCCAAGCAGAAAACAAGCAGCCCTCGGTGA

Predicted protein sequences of Glyma20g36170

Limit To All Plant Sequences

>Glyma20g36170.1   sequence type=predicted peptide   gene model=Glyma20g36170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDDRVVIKDPNPNLFFASQVINNACATQAILSILMNSPDIDIGPELTKLKEFTKNFPPELKGLAINNSEAIRTAHNSFARPEPFVPEEQKVASKDDDVYHFISYLPVDGVLYELDGLKEGPISLGQCSGGQGDMEWLKMVQPVIQERIERYSQSEIRFNLLAVIKNRKEMYTAELKELQKRRERILQQLAASKSDRLVDNSSFEALNNSLSEVNAGIEAATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTSSPR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain