SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g35080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g35080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g35080

Feature Type:gene_model
Chromosome:Gm20
Start:43364465
stop:43364872
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g35080
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G62510AT Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | chr1:23136632-23137081 REVERSE LENGTH=149 SoyBaseE_val: 5.00E-30ISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0008289GO-mf Annotation by Michelle Graham. GO Molecular Function: lipid binding SoyBaseN/AISS
PF00234PFAM Protease inhibitor/seed storage/LTP family JGI ISS
UniRef100_Q0PIW2UniRef Annotation by Michelle Graham. Most informative UniRef hit: HyPRP2 n=1 Tax=Gossypium hirsutum RepID=Q0PIW2_GOSHI SoyBaseE_val: 6.00E-30ISS
UniRef100_UPI000233DC85UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DC85 related cluster n=1 Tax=unknown RepID=UPI000233DC85 SoyBaseE_val: 1.00E-89ISS

Expression Patterns of Glyma20g35080
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g35080 not represented in the dataset
Glyma20g35080 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g35080 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g208400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g35080
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g35080
>Glyma20g35080.2   sequence type=CDS   gene model=Glyma20g35080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCGAAAATGTGTGTTTTTGTGGCACTTAATGTTGTTGTGTTCTTTGCAGTTGTATCTGGATGTGATAAGTGCTCAGCCGTGACAAACACGAGTGTCGATACTACTGTAGTTATTACTGCTACAACTACTCTCTCGTCCGATGTGGGGTGTCCTCGTAACGTGCTCAAACTAGGTGTGTGCTCAAGTATTCTAAATGGGTGGATGAATTTTACGACAGGTCTACCCCCAGAGACACAATGTTGCTCCGCAATCGCAGACCTTTATGGCTTAGAAGTTGCAGTGTGCCTTTGCACTGCCCTGAAAGCAAACATTATGGGTATCAACCTCGGTATTCCCATTTCCTTTACCAAGCTTATCAACACTTGCGATAAGAAAGTTCCAAATGGTTTCATATGTGGCTGA
Predicted protein sequences of Glyma20g35080
>Glyma20g35080.2   sequence type=predicted peptide   gene model=Glyma20g35080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKMCVFVALNVVVFFAVVSGCDKCSAVTNTSVDTTVVITATTTLSSDVGCPRNVLKLGVCSSILNGWMNFTTGLPPETQCCSAIADLYGLEVAVCLCTALKANIMGINLGIPISFTKLINTCDKKVPNGFICG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo