SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g34560

Feature Type:gene_model
Chromosome:Gm20
Start:42927661
stop:42928065
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g34560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23230AT Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr3:8289647-8290066 REVERSE LENGTH=139 SoyBaseE_val: 9.00E-46ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_I1NI28UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NI28_SOYBN SoyBaseE_val: 5.00E-94ISS
UniRef100_Q9LTC5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor ERF098 n=1 Tax=Arabidopsis thaliana RepID=ERF98_ARATH SoyBaseE_val: 4.00E-43ISS

Expression Patterns of Glyma20g34560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g34560
ParalogEvidenceComments
Glyma10g33070 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g34560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g203600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g34560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g34560
>Glyma20g34560.1   sequence type=CDS   gene model=Glyma20g34560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAGCACCAGAAGGCTGGGAAGCTGCAGGGAAAGGAAGAGGTGCGGTACCGCGGCGTGCGGCGGCGGCCGTGGGGAAAGTACGCGGCGGAGATAAGGGATCCATCGAAGCAAGGGTCAAGGCTGTGGTTGGGGACATTTGACACTGCTGAAGAAGCTGCTAGAGCTTATGACCGTGCAGCTTTTAACCTAAGGGGCCATCTTGCGATTCTCAATTTTCCTAGTGAGTACTATTCTCAGATAAGGGGTTCACCACCATATCCACCTCATTTAGCAACACCATCTTCCTCTTCTGGTGCACAACAGAGGCCTGTTTTTGAGATTCCGTGTTTGGATGATAAGGTGTTGGAGGATCTTCTTGGTCAGTCAGAGGAACACAAGAAGAAAAACAAGGGAGATTAA
Predicted protein sequences of Glyma20g34560
>Glyma20g34560.1   sequence type=predicted peptide   gene model=Glyma20g34560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEHQKAGKLQGKEEVRYRGVRRRPWGKYAAEIRDPSKQGSRLWLGTFDTAEEAARAYDRAAFNLRGHLAILNFPSEYYSQIRGSPPYPPHLATPSSSSGAQQRPVFEIPCLDDKVLEDLLGQSEEHKKKNKGD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo