SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g33800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g33800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g33800

Feature Type:gene_model
Chromosome:Gm20
Start:42295186
stop:42297489
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g33800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G07580AT Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr5:2399525-2400349 FORWARD LENGTH=274 SoyBaseE_val: 2.00E-38ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_C6SY34UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SY34_SOYBN SoyBaseE_val: 3.00E-147ISS
UniRef100_G7I303UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor n=1 Tax=Medicago truncatula RepID=G7I303_MEDTR SoyBaseE_val: 6.00E-69ISS

Expression Patterns of Glyma20g33800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g33800 not represented in the dataset
Glyma20g33800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g33800
ParalogEvidenceComments
Glyma10g33810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g33800 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g195900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g33800
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g33800
>Glyma20g33800.1   sequence type=CDS   gene model=Glyma20g33800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACAGCAGAAGAAATTTCAACTTTGAAACTGTTGCGCCAATATCTCTTGGGGGATATTTCAGACCCTTTTCTCACCAATCTCATTCCAGTAAAACTTGAAGACCCCTCATCAGGACTTGATATGGGTTCAAACTTCTCAGAACAAAGCAGCTTCTGCAAGTTTCTGGAGTGCTTTGATTTTGAAGCAGAAGTGGTAGGTCTCACTTCTCATCATAAGGTCCAAAGCTCCATTGCAACAAGTCCACCCCAGAATTTCAATTTTCCAGAAGAACCAATGGTGTCAATGAAAAAGGAAGCAACATGTTATGCAACAAGGCATTACAGAGGAGTGAGGAGAAGGCCATGGGGGAAGTTTGCGGCAGAGATTCGCGACCCCAAAAAGAAAGGGAGCAGGGTGTGGCTTGGCACATTTGACACTGAGATTGATGCTGCTAAGGCTTATGATTGTGCTGCCTTCAGAATGAGGGGTCATAAAGCCGTGTTGAATTTCCCTCTAGAGGCTGGAATGTCTCATCCAGAGCCCAACAGCAGTGGCAGGAAAAGGAGAAGAGAGTACACAACAGCTGCCACAAGTTCAAGGCATGTTATGTCATGA
Predicted protein sequences of Glyma20g33800
>Glyma20g33800.1   sequence type=predicted peptide   gene model=Glyma20g33800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATAEEISTLKLLRQYLLGDISDPFLTNLIPVKLEDPSSGLDMGSNFSEQSSFCKFLECFDFEAEVVGLTSHHKVQSSIATSPPQNFNFPEEPMVSMKKEATCYATRHYRGVRRRPWGKFAAEIRDPKKKGSRVWLGTFDTEIDAAKAYDCAAFRMRGHKAVLNFPLEAGMSHPEPNSSGRKRRREYTTAATSSRHVMS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo