Glyma20g32730 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g32730

Feature Type:	gene_model
Chromosome:	Gm20
Start:	41365782
stop:	41367293
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g32730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G25560	AT	Annotation by Michelle Graham. TAIR10: AP2/B3 transcription factor family protein \| chr1:8981891-8982976 REVERSE LENGTH=361	SoyBase	E_val: 6.00E-134	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0030003	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis	SoyBase	N/A	ISS
GO:0048573	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering	SoyBase	N/A	ISS
GO:0070838	GO-bp	Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
PF02362	PFAM	B3 DNA binding domain	JGI		ISS
UniRef100_Q45EZ4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RAV-like DNA-binding protein n=1 Tax=Glycine max RepID=Q45EZ4_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_UPI000233DA7E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DA7E related cluster n=1 Tax=unknown RepID=UPI000233DA7E	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma20g32730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g32730

Paralog	Evidence	Comments
Glyma10g34760	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g32730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g186200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g32730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g32730

Limit To All Plant Sequences

>Glyma20g32730.1   sequence type=CDS   gene model=Glyma20g32730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGGAGGCAGTGTCACAGACGAAACCACCACAACCAGCAACTCTCTTTCGGTTCCGGCGAATCTATCTCCGCCGCCTCTCAGCCTTGTCGGCAGCGGCGCAACCGCCGTCGTCTACCCCGACGGTTGTTGCGTCTCCGGCGAAGCCGAATCCCGGAAACTCCCGTCCTCGAAATACAAAGGCGTGGTGCCGCAACCGAACGGTCGTTGGGGAGCTCAGATTTACGAGAAGCACCAGCGCGTGTGGCTCGGCACCTTCAACGAGGAAGACGAAGCCGCCAGAGCCTACGACATCGCCGCGCATCGCTTCCGCGGCCGCGACGCCGTCACTAACTTCAAGCCTCTCGCCGGCGCCGACGACGCCGAAGCCGAGTTCCTCAGCACGCATTCCAAGTCCGAGATCGTCGACATGCTCCGCAAGCACACCTACGACAACGAGCTCCAGCAGAGCACCCGCGGCGGCAGGCGCCGCCGGGACGCCGAAACCGCGTCGAGCGGCGCGTTCGACGCGAAGGCGCGTGAGCAGCTGTTCGAGAAAACCGTTACGCAGAGCGACGTCGGGAAGCTGAACCGATTAGTGATACCAAAGCAGCACGCGGAGAAGCACTTTCCGTTAAGCGGATCCGGCGGCGGAGCCTTGCCGTGCATGGCGGCGGCTGCGGGGGCGAAGGGAATGTTGCTGAACTTTGAGGACGTTGGAGGGAAAGTGTGGCGGTTCCGTTACTCGTATTGGAACAGTAGCCAGAGCTACGTGCTTACCAAAGGATGGAGCCGGTTCGTTAAGGAGAAGAATCTTCGAGCTGGTGACGCGGTTCAGTTCTTCAAGTCGACCGGACTGGACCGGCAACTATATATAGACTGCAAGGCGAGGAGTGGTAAGGTTAACAATAATGCTGCCGGTTTGTTTATTCCGGTTGGACCGGTTGTTGAGCCGGTTCAGATGGTACGGCTTTTCGGGGTCGACCTTTTGAAACTACCCGTACCCGGTTCGGATGGTATTGGGGTTGGCTGTGACGGGAAGAGAAAAGAGATGGAGCTGTTTGCATTTGAATGTAGCAAGAAGTTAAAAGTAATTGGAGCTTTGTAA

Predicted protein sequences of Glyma20g32730

Limit To All Plant Sequences

>Glyma20g32730.1   sequence type=predicted peptide   gene model=Glyma20g32730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDGGSVTDETTTTSNSLSVPANLSPPPLSLVGSGATAVVYPDGCCVSGEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDIAAHRFRGRDAVTNFKPLAGADDAEAEFLSTHSKSEIVDMLRKHTYDNELQQSTRGGRRRRDAETASSGAFDAKAREQLFEKTVTQSDVGKLNRLVIPKQHAEKHFPLSGSGGGALPCMAAAAGAKGMLLNFEDVGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDAVQFFKSTGLDRQLYIDCKARSGKVNNNAAGLFIPVGPVVEPVQMVRLFGVDLLKLPVPGSDGIGVGCDGKRKEMELFAFECSKKLKVIGAL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain