SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g32550

Feature Type:gene_model
Chromosome:Gm20
Start:41162538
stop:41164008
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g32550
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04560AT Annotation by Michelle Graham. TAIR10: AWPM-19-like family protein | chr1:1245070-1245888 FORWARD LENGTH=186 SoyBaseE_val: 1.00E-91ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05512PFAM AWPM-19-like family JGI ISS
UniRef100_I1NHK2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NHK2_SOYBN SoyBaseE_val: 3.00E-126ISS
UniRef100_Q39872UniRef Annotation by Michelle Graham. Most informative UniRef hit: PGmPM3 n=1 Tax=Glycine max RepID=Q39872_SOYBN SoyBaseE_val: 2.00E-108ISS

Expression Patterns of Glyma20g32550
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g32550
ParalogEvidenceComments
Glyma10g35010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g32550 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g184600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g32550
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g32550
>Glyma20g32550.1   sequence type=CDS   gene model=Glyma20g32550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACAGTTGGAAGGAACGCAGCAGCTCCATTGCTGTTTCTTAACTTGATCATGTATTTTATTGTTCTTGGCTTTGCTAGTTGGTGCCTCAACAAGTTCATCAATGGCCAAACTTACCACCCTAGCTTTGGTGGAAATGGTGCAACTATGTTTTTCTTAATCTTCTCCATACTAGCAGCCGTTTTGGGCATAGTGTCCAAACTTTTGGGTGCGAATCACATTAGGACATGGAGGAGTGACAGTTTAGCATCTGCAGGAGCCACATCAATCGTTGCTTGGGCAGTCACTGCTCTAGCATTTGGGTTGGCTTGCAAGCAAATAAACATAGGAGGGCACAGAGGGTGGAGGCTGAGGGTAGTGGAGGCTTTCATAATAATACTCACATTGACACAGTTGTTGTACCTGATACTGATCCACGCAGGACTATATAGCAGTAGGTATGGTCCCGGGTACCGTGACACTGACTATGGTAATGCTCATGGTGTGGGAGGGACTACAGGAGATCCAATGCACAAGTCTGCTGCTGCTGGAACTCGTGTCTAA
Predicted protein sequences of Glyma20g32550
>Glyma20g32550.1   sequence type=predicted peptide   gene model=Glyma20g32550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATVGRNAAAPLLFLNLIMYFIVLGFASWCLNKFINGQTYHPSFGGNGATMFFLIFSILAAVLGIVSKLLGANHIRTWRSDSLASAGATSIVAWAVTALAFGLACKQINIGGHRGWRLRVVEAFIIILTLTQLLYLILIHAGLYSSRYGPGYRDTDYGNAHGVGGTTGDPMHKSAAAGTRV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo