SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g32005

Feature Type:gene_model
Chromosome:Gm20
Start:40621191
stop:40624131
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g32005
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37170AT Annotation by Michelle Graham. TAIR10: plasma membrane intrinsic protein 2 | chr2:15613624-15614791 REVERSE LENGTH=285 SoyBaseE_val: 3.00E-128ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0015250GO-mf Annotation by Michelle Graham. GO Molecular Function: water channel activity SoyBaseN/AISS
KOG0223 KOG Aquaporin (major intrinsic protein family) JGI ISS
PTHR19139Panther AQUAPORIN TRANSPORTER JGI ISS
PTHR19139:SF27Panther GLYCEROL UPTAKE FACILITATOR JGI ISS
PF00230PFAM Major intrinsic protein JGI ISS
UniRef100_I1NHF6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NHF6_SOYBN SoyBaseE_val: 2.00E-139ISS
UniRef100_O65357UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aquaporin 2 n=1 Tax=Samanea saman RepID=O65357_SAMSA SoyBaseE_val: 6.00E-131ISS

Expression Patterns of Glyma20g32005
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g32005 not represented in the dataset
Glyma20g32005 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g32005
ParalogEvidenceComments
Glyma10g35521 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g32005 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g179700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g32005
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g32005
>Glyma20g32005.1   sequence type=CDS   gene model=Glyma20g32005   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCTTCATCCTTGTCTACTGCACTGCTGGGATTTCAGGAGGTCACATTAACCCAGCAGTGACATTTGGGCTGTTTTTGGCTCGCAAGGTGTCTTTGATCCGAGCCATCATGTACATGGTGGCTCAGTGCTTGGGTGCTATCTGTGGAGTTGGTTTAGTTAAGGCTTTCCAAAAGTCTTACTTCAACAAGTATGGTGGTGGGGCTAATTCCCTCGCTGATGGGTACAGCACAGGTACTGGATTGGGTGCTGAGATCATTGGCACCTTTGTTTTGGTGTACACTGTCTTCTCTGCCACTGACCCTAAGAGGAATGCTAGAGATTCCCATGTTCCGGTTTTGGCTCCACTTCCCATTGGATTTGCTGTGTTCATGGTTCACTTGGCCACCATCCCAGTCACTGGCACTGGTATCAACCCTGCTAGGAGTCTTGGAGCTGCTGTTATCTACAACCAAGATAAGCCATGGGATGACCATTGGATCTTTTGGGTAGGACCATTTATTGGAGCAGCCATTGCAGCCTTCTACCACCAATTCATCTTGAGAGCAGGTGCAGCCAAGGCCCTTGGATCATTCAGGAGTAACCCCCATAATTGA
Predicted protein sequences of Glyma20g32005
>Glyma20g32005.1   sequence type=predicted peptide   gene model=Glyma20g32005   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSNPHN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo