SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g31571

Feature Type:gene_model
Chromosome:Gm20
Start:40192816
stop:40198131
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g31571
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G09600AT Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 3 | chr4:6073014-6073516 REVERSE LENGTH=99 SoyBaseE_val: 2.00E-28ISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02704PFAM Gibberellin regulated protein JGI ISS
UniRef100_B9SLF4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin-regulated protein 2, putative n=1 Tax=Ricinus communis RepID=B9SLF4_RICCO SoyBaseE_val: 6.00E-34ISS
UniRef100_I1NHA8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NHA8_SOYBN SoyBaseE_val: 3.00E-40ISS

Expression Patterns of Glyma20g31571
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g31571 not represented in the dataset
Glyma20g31571 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g31571
ParalogEvidenceComments
Glyma10g36021 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g31571 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g175800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g31571
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g31571
>Glyma20g31571.1   sequence type=CDS   gene model=Glyma20g31571   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATCACTAGAAGCACAGTGGTCTTGGCTATTCTCTGCTTCATCCTTATACGAGCTGAGTTGGGGATCTATGGTGAAGATTTGCACATGGATGCTGCCAAGAACATAGACTGCGGTGGGAAGTGCAATTACAGGTGCAGCAAGACTAGCAGACACAAAATGTGCATAAGGGCATGCAATAGTTGCTGCAAGACGTGCAGCTGCGTGCCACCAGGCACTTCTGGGAACCGAGATATGTGCCCTTGCTATGCTAGCCTCACCACACATGGAGGAAAGCTCAAGTGCCCATGA
Predicted protein sequences of Glyma20g31571
>Glyma20g31571.1   sequence type=predicted peptide   gene model=Glyma20g31571   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAITRSTVVLAILCFILIRAELGIYGEDLHMDAAKNIDCGGKCNYRCSKTSRHKMCIRACNSCCKTCSCVPPGTSGNRDMCPCYASLTTHGGKLKCP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo