SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g31520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g31520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g31520

Feature Type:gene_model
Chromosome:Gm20
Start:40145445
stop:40148003
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G09570AT Annotation by Michelle Graham. TAIR10: calcium-dependent protein kinase 4 | chr4:6049560-6052184 FORWARD LENGTH=501 SoyBaseE_val: 2.00E-155ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009789GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004683GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin-dependent protein kinase activity SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
KOG0027 KOG Calmodulin and related proteins (EF-Hand superfamily) JGI ISS
PTHR24349Panther SERINE/THREONINE-PROTEIN KINASE JGI ISS
PF00036PFAM EF hand JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_I1LD79UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LD79_SOYBN SoyBaseE_val: 0ISS
UniRef100_O24430UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin-like domain protein kinase isoenzyme beta n=1 Tax=Glycine max RepID=O24430_SOYBN SoyBaseE_val: 3.00E-168ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g31520 not represented in the dataset

Glyma20g31520 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g36090 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g175200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g31520.2   sequence type=CDS   gene model=Glyma20g31520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCCCTGAGGTTTTACGCAAGCAAACTGGACCAGAAGTGGATGTATGGAGTGCCGGTGTTATCCTATACATCTTACTGAGAGGGCACCCACCTTTCTGGGCAAAATCCGAATCAGCAATTTTCCAAGAGATTTTACATGGAGAGATTGATTTTGTTTCTGATCCGTGGCCAAGTATAACAGAAAGTGCTAAGGATTTGATAAAAAAAATGTTGGATAAGGACCCTGAGAAAAGAATTTCTGCTCATGAAGTCTTATGTCACCCTTGGATTGTTGATGATAGTGTTGCTCCTGACAAACCTCTGGACCCTGCTGTTTTGACACGCCTAAAGCATTTCTCAACTATGAATAAACTTCAGAAGATGGCATTACGTATCATAGCAGAAAGACTTTCAGAGGAAGAAATAGGTGGACTAAAAGAGTTATTTAAAATGATTGATGAAGACAATAGTGGGACAATCACTTTTGAGGAACTCAAGGATAGTTTGAAAAGTGTGGGCTGTGATCTCATAGAATCTGAAATTAAATTCCTTATGGAAGCGGCTGATATAGACAACAATGGAACAATAGACTATGGTGAATTTCTCGCTGCTACACTGCACTTGAATAAGATGGAAAGAGAAGAGAATTTGGTTGCTGCTTTTGCCTATTTTGATAAAGATGGTAGTGGTTACATCACCATTGAAGAGATTCAACAGGCTTGTAAAGACTTTGGCCTTGGTAATTTGCACCTGGATGAGATAATCAATGAGATTGATCAAGACAACGATGGGAGAATAAATTATGCAGAGTTTGCAGCAATGATGAGAAAGGGTGGTCCGGATGTTGGTAGGAGCAGAAAAGACAATTACAATGCTTCATTATTGGATATGCTTGTGGAGTGA

>Glyma20g31520.2   sequence type=predicted peptide   gene model=Glyma20g31520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPEVLRKQTGPEVDVWSAGVILYILLRGHPPFWAKSESAIFQEILHGEIDFVSDPWPSITESAKDLIKKMLDKDPEKRISAHEVLCHPWIVDDSVAPDKPLDPAVLTRLKHFSTMNKLQKMALRIIAERLSEEEIGGLKELFKMIDEDNSGTITFEELKDSLKSVGCDLIESEIKFLMEAADIDNNGTIDYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIEEIQQACKDFGLGNLHLDEIINEIDQDNDGRINYAEFAAMMRKGGPDVGRSRKDNYNASLLDMLVE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo