SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g31415): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g31415): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g31415

Feature Type:gene_model
Chromosome:Gm20
Start:40037274
stop:40039832
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g31415
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G22710AT Annotation by Michelle Graham. TAIR10: sucrose-proton symporter 2 | chr1:8030911-8032970 REVERSE LENGTH=512 SoyBaseE_val: 2.00E-46ISS
GO:0009915GO-bp Annotation by Michelle Graham. GO Biological Process: phloem sucrose loading SoyBaseN/AISS
GO:0015770GO-bp Annotation by Michelle Graham. GO Biological Process: sucrose transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005351GO-mf Annotation by Michelle Graham. GO Molecular Function: sugar:hydrogen symporter activity SoyBaseN/AISS
GO:0008506GO-mf Annotation by Michelle Graham. GO Molecular Function: sucrose:hydrogen symporter activity SoyBaseN/AISS
GO:0008515GO-mf Annotation by Michelle Graham. GO Molecular Function: sucrose transmembrane transporter activity SoyBaseN/AISS
GO:0015144GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate transmembrane transporter activity SoyBaseN/AISS
PTHR19432Panther SUCROSE TRANSPORT PROTEIN JGI ISS
PTHR19432:SF2Panther PROSTEIN PROTEIN JGI ISS
UniRef100_Q7XA53UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sucrose transporter n=1 Tax=Glycine max RepID=Q7XA53_SOYBN SoyBaseE_val: 1.00E-69ISS
UniRef100_UPI000233DB05UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DB05 related cluster n=1 Tax=unknown RepID=UPI000233DB05 SoyBaseE_val: 3.00E-78ISS

Expression Patterns of Glyma20g31415
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g31415 not represented in the dataset
Glyma20g31415 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g31415
ParalogEvidenceComments
Glyma10g36200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g31415 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g174200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g31415
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g31415
>Glyma20g31415.1   sequence type=CDS   gene model=Glyma20g31415   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGAACTCCCTTGTGCTCGCTGCGACGTCGTTGGGAGTGGAAGTTCTGGCGCGTGGGGTTGGGGGCGTCAAGAGGCTGTGGGGGATTGTTAACTTCTTGCTCGCTCTTTGTTTGGCCATCACCGTTTTGGTTACCAAGTTGGCCCAACACACCCTACTCCCCAACTCCCACCAGGAACCGCTGCCTCCTCCCGCCGCCGTCAAAGCCGCCGCGTTGGCTCTCTTCTCCGTCCTCGGAATCCCACTCGCGATTACTTACAGCATACCCTTTGCTCTAGCATCAATATTCTCCAGTACCTCAGGGGCAGGCCAAGGTTTATCTCTGGGAGTACTCAATCTTGCAATTGTCATACCACAAATGGTGGTGTCTGTGATAAGTGGACCATGA
Predicted protein sequences of Glyma20g31415
>Glyma20g31415.1   sequence type=predicted peptide   gene model=Glyma20g31415   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLNSLVLAATSLGVEVLARGVGGVKRLWGIVNFLLALCLAITVLVTKLAQHTLLPNSHQEPLPPPAAVKAAALALFSVLGIPLAITYSIPFALASIFSSTSGAGQGLSLGVLNLAIVIPQMVVSVISGP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo