SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g31200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g31200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g31200

Feature Type:gene_model
Chromosome:Gm20
Start:39850442
stop:39855404
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G14290AT Annotation by Michelle Graham. TAIR10: sphingoid base hydroxylase 2 | chr1:4880307-4881784 REVERSE LENGTH=259 SoyBaseE_val: 2.00E-121ISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0046520GO-bp Annotation by Michelle Graham. GO Biological Process: sphingoid biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0000170GO-mf Annotation by Michelle Graham. GO Molecular Function: sphingosine hydroxylase activity SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0874 KOG Sphingolipid hydroxylase JGI ISS
PTHR11863Panther STEROL DESATURASE JGI ISS
PTHR11863:SF3Panther SUR2-RELATED JGI ISS
PF04116PFAM Fatty acid hydroxylase superfamily JGI ISS
UniRef100_B9SM94UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sur2 hydroxylase/desaturase, putative n=1 Tax=Ricinus communis RepID=B9SM94_RICCO SoyBaseE_val: 1.00E-154ISS
UniRef100_C6TF38UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TF38_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g31200 not represented in the dataset

Glyma20g31200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g36370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g172000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g31200.1   sequence type=CDS   gene model=Glyma20g31200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTTCTGGGAAGGATATGTGAGCGATGAATTGATGGGCACGTTTGCCCCTATTGTGCTTTATTGGGTATATGCTGGGTTTTATCACTTGCTCCCACCTTTAGATAGGTATCGGTTGCATACCAGGAGAGATGAGGAAACGAAGAATTTGGTGCCCTTTTCAACAGTTGTGAAGGGTGTTTTACTTCAGCAGCTTGTTCAGGCAATTGTAGCACTCTTCTTGTTGACCGCAACAGCAAGTGCATCTGGGGTTATAGTGCAGCCTTCTATCCCCAAGCAAATTTTGCAGATTGCTATTGCAATGTTTGTGATGGATACATGGCAGTACTTTGTGCATCGGTATATGCATCAGAACAAGTTCTTATATCGCCATATCCACTCCCAGCATCACAGACTGGTTGTTCCTTATGCAATAGGAGCCCTTTACAATCACCCCATTGAGGGTCTTCTACTTGACACTGTAGGTGGGGCAATCTCATATCTTGTCTCAGGGATGACTGCAAGAACAGCAGCTGTATTCTTCTGCTTCGCTGTTGTGAAAACTGTTGATGATCACTGTGGACTGTGGTTGCCTGGCAACATCTTCCATATCTTTTTCCAGAATAACACAGCTTACCATGACATTCATCATCAACTGCAAGGGCTGAAGTACAATTATTCTCAGCCATTCTTTTCCATATGGGACAAACTTCTTGGGACATACATGCCTTTCGATCTTGTAAAGCGGCCCAAAGGGGGGTTTGAGGCAAGGCTAGCAAAGGAATAG

>Glyma20g31200.1   sequence type=predicted peptide   gene model=Glyma20g31200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVFWEGYVSDELMGTFAPIVLYWVYAGFYHLLPPLDRYRLHTRRDEETKNLVPFSTVVKGVLLQQLVQAIVALFLLTATASASGVIVQPSIPKQILQIAIAMFVMDTWQYFVHRYMHQNKFLYRHIHSQHHRLVVPYAIGALYNHPIEGLLLDTVGGAISYLVSGMTARTAAVFFCFAVVKTVDDHCGLWLPGNIFHIFFQNNTAYHDIHHQLQGLKYNYSQPFFSIWDKLLGTYMPFDLVKRPKGGFEARLAKE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo