Glyma20g30940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g30940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g30940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g30940

Feature Type:	gene_model
Chromosome:	Gm20
Start:	39600428
stop:	39603894
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g30940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G34000	AT	Annotation by Michelle Graham. TAIR10: one-helix protein 2 \| chr1:12358151-12358902 REVERSE LENGTH=172	SoyBase	E_val: 3.00E-60	ISS
GO:0009637	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to blue light	SoyBase	N/A	ISS
GO:0009642	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to light intensity	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0010114	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to red light	SoyBase	N/A	ISS
GO:0010155	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of proton transport	SoyBase	N/A	ISS
GO:0010218	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to far red light	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_G7IBV7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: One-helix protein n=1 Tax=Medicago truncatula RepID=G7IBV7_MEDTR	SoyBase	E_val: 3.00E-68	ISS
UniRef100_I1NH47	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NH47_SOYBN	SoyBase	E_val: 7.00E-121	ISS

Expression Patterns of Glyma20g30940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g30940 not represented in the dataset	Glyma20g30940 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g30940

Paralog	Evidence	Comments
Glyma10g36650	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g30940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g169500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g30940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g30940

Limit To All Plant Sequences

>Glyma20g30940.1   sequence type=CDS   gene model=Glyma20g30940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGTGGCATCTTCATTTCCATGCATCAAAGTCCCAGCTTGTTCCTCCTCTCCATCATGCACATCTTCATCAACTTCATCATTTAGATTTTCTTCTTCCAAGCCTCATGCTGCTGTTTCTATAAGGAACTCCCAGACTGAAGGGCCTCTGAGAAGACCAGTGGCTCCTTCAGTGAGAGAACCATCAAGTAGTGTCCCTCAGCCACTGAAGCCTTCAGCTCCTTCTCAGGTTCCACCCCTGAAGGCTTCTCCTGTTGCTGGGGATGATAAGAATGTCATTACATTAGAGTTTCAGAGGCAGAAGGCTAAGGAGCTGCAGGAGTACTTCAAACAGAAGAAGCTGGAAGATGCAAATCAGGGTCCTTTCTTTGGCTTCATTGGCAAAAATGAGATTAGCAACGGAAGATGGGCTATGTTTGGTTTTGCTGTTGGATTGCTAACAGAGTATGCAACAGGATCAGATTTTGTTGATCAAGTAAAGATCCTTCTATCAAATTTTGGGATAGTAGATTTGGAATGA

Predicted protein sequences of Glyma20g30940

Limit To All Plant Sequences

>Glyma20g30940.1   sequence type=predicted peptide   gene model=Glyma20g30940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSVASSFPCIKVPACSSSPSCTSSSTSSFRFSSSKPHAAVSIRNSQTEGPLRRPVAPSVREPSSSVPQPLKPSAPSQVPPLKASPVAGDDKNVITLEFQRQKAKELQEYFKQKKLEDANQGPFFGFIGKNEISNGRWAMFGFAVGLLTEYATGSDFVDQVKILLSNFGIVDLE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain