SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g30910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g30910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g30910

Feature Type:gene_model
Chromosome:Gm20
Start:39574060
stop:39576581
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G71695AT Annotation by Michelle Graham. TAIR10: Peroxidase superfamily protein | chr1:26964359-26966557 FORWARD LENGTH=358 SoyBaseE_val: 2.00E-163ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0048653GO-bp Annotation by Michelle Graham. GO Biological Process: anther development SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004601GO-mf Annotation by Michelle Graham. GO Molecular Function: peroxidase activity SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PF00141PFAM Peroxidase JGI ISS
UniRef100_I1NH45UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NH45_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q43854UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxidase n=1 Tax=Vigna angularis RepID=Q43854_PHAAN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g30910 not represented in the dataset

Glyma20g30910 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g36680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g169200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g30910.1   sequence type=CDS   gene model=Glyma20g30910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTATTTCTTGTATGAGTGCTATTTTAAGCTTTCTTCTCATCTCTATCTTTCTTTCTGTTTACAATATTGAAGTGTGTGAGGCACAAGCCAGGCCTCCTACAGCGAAGGGGCTATCATACACCTTCTACGACAAAAGCTGTCCTAAGCTTAAATCTATCGTTAGATCAGAGCTCAAAAAGGTCTTCAATAAGGACATTGCTCAAGCTGCTGGCTTGCTTCGCCTTCACTTCCATGACTGCTTTGTTCAGGGTTGTGATGGATCAGTATTATTGGATGGATCAGCAAGTGGGCCGGGTGAGAAAGAAGCGCCACCAAACTTGACTTTGAGACCTGAGGCATTTAAGATCATCGAAAACCTTCGTGGTCTTTTAGAAAAGAGTTGTGGAAGAGTCGTCTCCTGCTCCGACATCACTGCTCTCACTGCACGTGATGCTGTTTTCCTTTCAGGAGGACCAGACTATGAGATTCCTTTGGGAAGAAGAGATGGGCTAACCTTTGCCACAAGACAAGTGACATTGGACAACCTTCCACCACCCTCAAGCAACGCTTCAACCATCCTAAGCTCCCTCGCCACCAAAAACCTCGACCCCACCGACGTCGTAGCGCTCTCAGGCGGCCACACCATAGGCATCAGCCACTGCAGCTCCTTCACCAACAGGCTCTACCCCACACAAGACCCCGTCATGGACAAGACCTTCGGCAACAACCTCAGACGCACGTGCCCCGCCGCCAACACCGACAACACCACTGTGCTTGACATCCGATCCCCCAACACCTTCGACAACAAGTACTACGTTGACCTCCTGAACCGCCAGGGCCTCTTCACCTCCGACCAAGACTTGTACACTGATAAAAGGACTAAGGGCATTGTCTCCGACTTTGCCGTCAACCAGAACCTCTTCTTTGAGAAGTTTGTGTTCGCTATGCTCAAGATGGGTCAGCTTAATGTGCTCACCGGGAAACAAGGGGAGATTCGTGCCAATTGCTCCGTTAGAAATGCCAATAACAAGTCCCTCTTGACTTCTGTGGTGGAAGATGTGGTGGAAACTTTGATAGAAATGTAA

>Glyma20g30910.1   sequence type=predicted peptide   gene model=Glyma20g30910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASISCMSAILSFLLISIFLSVYNIEVCEAQARPPTAKGLSYTFYDKSCPKLKSIVRSELKKVFNKDIAQAAGLLRLHFHDCFVQGCDGSVLLDGSASGPGEKEAPPNLTLRPEAFKIIENLRGLLEKSCGRVVSCSDITALTARDAVFLSGGPDYEIPLGRRDGLTFATRQVTLDNLPPPSSNASTILSSLATKNLDPTDVVALSGGHTIGISHCSSFTNRLYPTQDPVMDKTFGNNLRRTCPAANTDNTTVLDIRSPNTFDNKYYVDLLNRQGLFTSDQDLYTDKRTKGIVSDFAVNQNLFFEKFVFAMLKMGQLNVLTGKQGEIRANCSVRNANNKSLLTSVVEDVVETLIEM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo