SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g30850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g30850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g30850

Feature Type:gene_model
Chromosome:Gm20
Start:39537159
stop:39537725
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g30850
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24640AT Annotation by Michelle Graham. TAIR10: Plant invertase/pectin methylesterase inhibitor superfamily protein | chr4:12717851-12718804 FORWARD LENGTH=187 SoyBaseE_val: 3.00E-10ISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004857GO-mf Annotation by Michelle Graham. GO Molecular Function: enzyme inhibitor activity SoyBaseN/AISS
GO:0030599GO-mf Annotation by Michelle Graham. GO Molecular Function: pectinesterase activity SoyBaseN/AISS
GO:0046910GO-mf Annotation by Michelle Graham. GO Molecular Function: pectinesterase inhibitor activity SoyBaseN/AISS
PF04043PFAM Plant invertase/pectin methylesterase inhibitor JGI ISS
UniRef100_B9SE94UniRef Annotation by Michelle Graham. Most informative UniRef hit: C, putative n=1 Tax=Ricinus communis RepID=B9SE94_RICCO SoyBaseE_val: 5.00E-12ISS
UniRef100_UPI000233DAADUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DAAD related cluster n=1 Tax=unknown RepID=UPI000233DAAD SoyBaseE_val: 1.00E-126ISS

Expression Patterns of Glyma20g30850
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g30850 not represented in the dataset
Glyma20g30850 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g30850
ParalogEvidenceComments
Glyma10g36740 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g30850 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g168700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g30850
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g30850
>Glyma20g30850.2   sequence type=CDS   gene model=Glyma20g30850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGCTTCAGCATTATGTTCTCTGATGCTCACCCTTTGCTTGATCCTAATTTCTTATTCTCTTTTGCTAGCAAATGCTAAAGCCAATGGTGATCATTGCCTACTTGGAAATAGTCAGCAGATGATTGACCAAATTTGCAACCAAACCTCACAGAATGAAAACGAGTGCCTTAAGATTTTAAAAGCAGATCCTAAAATCGTGCAAGCAAAAGACTATTTTGAAATTTCAAAGGCGATCCTAAAGTTGGCCACGAAGAAGGCAAAAGAAGGACAGCACTTCCTCAAAGGGTTGGCACATAAAACCGGTTCTGCAGCCATTGCTTTGTGTGCAAACCAATGGTATCCTTACACGGTTGGATCGTTCGGGAGTGCCCTAGGTGAGTTGAAAGAAAGTCCTGATACTGCTAATTATGATGCAAAAGTTGCTGGTGATGGACCTGTATACTGTGATGAAGCCATTGCCAAAGCACATATTGTTAACCCTGCCATTTCTGCTCTTAACCACAAAACTTCGTTGCTTAGCTTTATTGCATTCCTAGCCACAAATTGTCTTTCAGAAGAGTAA
Predicted protein sequences of Glyma20g30850
>Glyma20g30850.2   sequence type=predicted peptide   gene model=Glyma20g30850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNASALCSLMLTLCLILISYSLLLANAKANGDHCLLGNSQQMIDQICNQTSQNENECLKILKADPKIVQAKDYFEISKAILKLATKKAKEGQHFLKGLAHKTGSAAIALCANQWYPYTVGSFGSALGELKESPDTANYDAKVAGDGPVYCDEAIAKAHIVNPAISALNHKTSLLSFIAFLATNCLSEE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo