SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g30110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g30110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g30110

Feature Type:gene_model
Chromosome:Gm20
Start:38834698
stop:38837263
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g30110
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G15750AT Annotation by Michelle Graham. TAIR10: Alpha-L RNA-binding motif/Ribosomal protein S4 family protein | chr5:5141449-5142701 FORWARD LENGTH=182 SoyBaseE_val: 9.00E-114ISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0019843GO-mf Annotation by Michelle Graham. GO Molecular Function: rRNA binding SoyBaseN/AISS
KOG4655 KOG U3 small nucleolar ribonucleoprotein (snoRNP) component JGI ISS
PTHR11831Panther 30S 40S RIBOSOMAL PROTEIN JGI ISS
PTHR11831:SF1Panther 40S RIBOSOMAL PROTEIN S9 JGI ISS
PF00163PFAM Ribosomal protein S4/S9 N-terminal domain JGI ISS
PF01479PFAM S4 domain JGI ISS
UniRef100_B7FMK3UniRef Annotation by Michelle Graham. Most informative UniRef hit: U3 small nucleolar ribonucleoprotein IMP3 n=2 Tax=Medicago truncatula RepID=B7FMK3_MEDTR SoyBaseE_val: 2.00E-120ISS
UniRef100_C6TBL4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TBL4_SOYBN SoyBaseE_val: 2.00E-131ISS

Expression Patterns of Glyma20g30110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g30110 not represented in the dataset
Glyma20g30110 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g30110
ParalogEvidenceComments
Glyma10g37720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g30110 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g161600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g30110
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g30110
>Glyma20g30110.1   sequence type=CDS   gene model=Glyma20g30110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAAGCTAAAGTTTCATGAAAAGAAGCTTTTGAAGAAGGTTAATTTTTTGGAATGGAAGAGGGAAGGGGGTCACAGAGAGAACCTCATTATGCAACGCTACCATGTTACTGGACGGGACGATTACAAAAAATATTCAGGTTTATGCCATATGGTTCAGAAGTTAGTAAACATATTGAAACAGATGGACCCAAAGGATCCTTTTCGGGTTGATATGACTGATAAGCTTTTGGAGAAACTCTACAACATGGGTGTGATTCCAACCAGGCAAAGCATCACACTATGCGAACGTTTAACTGTGTCATCCTTCTGTAGGCGTAGGCTCTCAACTGTTTTGGTGAGACTAAAATTTGCTGAGCACTTGAAAGAAGCTGTCACGTACATTGAGCAAGGGCATATACGAGTTGGTCCAGAGACAGTTACAGACCCGGCTTTCCTTGTAACTAGAAACATGGAAGACTTCGTTACATGGGTGGATTCATCCAAAATAAAGAGAAAGGTGCTTCAGTACAATGACAAATTGGATGACTATGATTTAATGAATTAA
Predicted protein sequences of Glyma20g30110
>Glyma20g30110.1   sequence type=predicted peptide   gene model=Glyma20g30110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKLKFHEKKLLKKVNFLEWKREGGHRENLIMQRYHVTGRDDYKKYSGLCHMVQKLVNILKQMDPKDPFRVDMTDKLLEKLYNMGVIPTRQSITLCERLTVSSFCRRRLSTVLVRLKFAEHLKEAVTYIEQGHIRVGPETVTDPAFLVTRNMEDFVTWVDSSKIKRKVLQYNDKLDDYDLMN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo