Glyma20g29920 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g29920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g29920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g29920

Feature Type:	gene_model
Chromosome:	Gm20
Start:	38716344
stop:	38717817
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g29920

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G20850	AT	Annotation by Michelle Graham. TAIR10: tripeptidyl peptidase ii \| chr4:11160935-11169889 REVERSE LENGTH=1380	SoyBase	E_val: 9.00E-59	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009630	GO-bp	Annotation by Michelle Graham. GO Biological Process: gravitropism	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0004252	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity	SoyBase	N/A	ISS
GO:0008240	GO-mf	Annotation by Michelle Graham. GO Molecular Function: tripeptidyl-peptidase activity	SoyBase	N/A	ISS
PTHR10795	Panther	SUBTILISIN/KEXIN-RELATED SERINE PROTEASE	JGI		ISS
PTHR10795:SF2	Panther	SUBTILISIN-RELATED SERINE PROTEASE	JGI		ISS
PF00082	PFAM	Subtilase family	JGI		ISS
UniRef100_G7IAM4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Tripeptidyl-peptidase n=1 Tax=Medicago truncatula RepID=G7IAM4_MEDTR	SoyBase	E_val: 2.00E-71	ISS
UniRef100_I1NGU5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1NGU5_SOYBN	SoyBase	E_val: 2.00E-100	ISS

Expression Patterns of Glyma20g29920

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g29920 not represented in the dataset	Glyma20g29920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g29920

Paralog	Evidence	Comments
Glyma10g37900	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g29920 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g159800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g29920

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g29920

Limit To All Plant Sequences

>Glyma20g29920.1   sequence type=CDS   gene model=Glyma20g29920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTGAACGGGTCAACCTTCCTGGCTTCCCTCATGCCCAAGACGGAGATTGGCGCCGACCGATTCCTCCATTCTCACCCACACTACGATGGTCGCGGTGCTCTCATCGCTATCTTCGATTCTGGGGTAGACCCGGCTGCTGCTGGATTACAGGTTAGCTCAGATGGGAAACCAAAAATTATTGATATTCTTGGTTGCACCGGGAGTGGAAATATTGATACCTCAAAGGTGGTGAAGGCCAATGCTGATGGTTGTACTTCTGGGGCTTCAGGGGCATCTTTGGTTATCAATACTTCATGGAAAAATCCATCAGGTGACTGGCATGTGGGTTATAAATTGGTTTGTGAGCTCTTTACAGAAAATTTGACTTCTCGTTTGATGAAAGAAAGAAGAAGTGGGATGAGAAAAACCAGGAGGAAATTGCAAAGGCTGTAA

Predicted protein sequences of Glyma20g29920

Limit To All Plant Sequences

>Glyma20g29920.1   sequence type=predicted peptide   gene model=Glyma20g29920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LNGSTFLASLMPKTEIGADRFLHSHPHYDGRGALIAIFDSGVDPAAAGLQVSSDGKPKIIDILGCTGSGNIDTSKVVKANADGCTSGASGASLVINTSWKNPSGDWHVGYKLVCELFTENLTSRLMKERRSGMRKTRRKLQRL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain