Glyma20g29520 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g29520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g29520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g29520

Feature Type:	gene_model
Chromosome:	Gm20
Start:	38365272
stop:	38368966
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g29520

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G51940	AT	Annotation by Michelle Graham. TAIR10: RNA polymerase Rpb6 \| chr5:21104679-21105796 FORWARD LENGTH=144	SoyBase	E_val: 5.00E-75	ISS
GO:0000394	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation	SoyBase	N/A	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006366	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter	SoyBase	N/A	ISS
GO:0000418	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: DNA-directed RNA polymerase IV complex	SoyBase	N/A	ISS
GO:0000419	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: DNA-directed RNA polymerase V complex	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005665	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: DNA-directed RNA polymerase II, core complex	SoyBase	N/A	ISS
GO:0030880	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: RNA polymerase complex	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003899	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity	SoyBase	N/A	ISS
KOG3405	KOG	RNA polymerase subunit K	JGI		ISS
PTHR10773	Panther	DNA-DIRECTED RNA POLYMERASE SUBUNIT RPB6	JGI		ISS
PF01192	PFAM	RNA polymerase Rpb6	JGI		ISS
UniRef100_I1NGQ5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NGQ5_SOYBN	SoyBase	E_val: 2.00E-94	ISS
UniRef100_Q9FJ98	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerase II subunit-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9FJ98_ARATH	SoyBase	E_val: 3.00E-72	ISS

Expression Patterns of Glyma20g29520

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g29520 not represented in the dataset	Glyma20g29520 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g29520

Paralog	Evidence	Comments
Glyma10g38350	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g29520 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g155900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g29520

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g29520

Limit To All Plant Sequences

>Glyma20g29520.1   sequence type=CDS   gene model=Glyma20g29520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGACGAGGACTATGAAGATATTGACATGGGGTACGAAGATGAACCGCCAGAGCCCGAGATTGAGGAAGGTGCAGAGGAAGATGTGGAGAACAAAAACGATGAAATAACTGGAGAGCCTATTGACACCGAGGATAAGGAAGAGGAACAACCAGTGAAGCGGCCTCGAAAGACATCGAAATATATGACTAAGTATGAGCGTGCTAGAATTTTGGGCACCCGTGCTCTTCAAATCAGTATGAATGCACCTGTCATGGTCGAGTTGGAGGGGGAAACTGACCCACTCGAGATTGCTATGAAGGAGCTTCGAGAGCGGAAAATACCCTTTACAATTCGGCGCTACTTGCCTGATGGAAGCTATGAAGATTGGGGAGTTGATGAACTGATTGTGGAAGACTCCTGGAAGAGGCAAGTGGGTGGTGATTGA

Predicted protein sequences of Glyma20g29520

Limit To All Plant Sequences

>Glyma20g29520.1   sequence type=predicted peptide   gene model=Glyma20g29520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADEDYEDIDMGYEDEPPEPEIEEGAEEDVENKNDEITGEPIDTEDKEEEQPVKRPRKTSKYMTKYERARILGTRALQISMNAPVMVELEGETDPLEIAMKELRERKIPFTIRRYLPDGSYEDWGVDELIVEDSWKRQVGGD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain