SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g29040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g29040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g29040

Feature Type:gene_model
Chromosome:Gm20
Start:37995152
stop:37997368
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g29040
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G62200AT Annotation by Michelle Graham. TAIR10: Embryo-specific protein 3, (ATS3) | chr5:24984463-24985674 REVERSE LENGTH=190 SoyBaseE_val: 3.00E-71ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06232PFAM Embryo-specific protein 3, (ATS3) JGI ISS
UniRef100_G7ID53UniRef Annotation by Michelle Graham. Most informative UniRef hit: Embryo-specific protein n=1 Tax=Medicago truncatula RepID=G7ID53_MEDTR SoyBaseE_val: 4.00E-102ISS
UniRef100_I1NGL9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NGL9_SOYBN SoyBaseE_val: 3.00E-136ISS

Expression Patterns of Glyma20g29040
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g29040 not represented in the dataset
Glyma20g29040 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g29040
ParalogEvidenceComments
Glyma10g38690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g29040 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g152100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g29040
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g29040
>Glyma20g29040.1   sequence type=CDS   gene model=Glyma20g29040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCAAACAAGTTCTTCTTCTTGTTCTGCTCTTCTTGGCCTCTGGATTGGCCCTCTCAGTCTCAGAGTCTGAGTCTGTTTCTCTTCTGCCTCACGCCGCTGATTCCTTCAATGTTAGCTATATCCAGATGAAGAACGCTGGGACTTGCTCTTACTCGGTGGTTATAACTACTAGCTGTTCGTCTCCTAGGTATACAAGGGATCAGATCAGTATTTCTTTTGGGGATGCTTATGGCAACCAGATATATGCGCCAAGACTGGATGATCCAGCTTCAGGTACATTCGAGAGCTGTTCTTCAGATACATTTCAGATAACTGGTCCGTGTGCATATCAGATATGTTATGTGTACCTATATAGATCTGGATTAGATGGCTGGAAGCCTGAAAGTGTGAAAATAAATGGTTATAACGGCAGGCCTGTTACTTTCTATTACAACACATATATCCCCAGAGATACGTGGTATGGATTTAATTTGTGCAACGGTGCTTCTTCTTCTTCTTCATACCAGGTATCTATGCAGAAATGGCTTATATTTATGGTTCTAGGATTTGTTCTTAGCTGTTGGTTGTAA
Predicted protein sequences of Glyma20g29040
>Glyma20g29040.1   sequence type=predicted peptide   gene model=Glyma20g29040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIKQVLLLVLLFLASGLALSVSESESVSLLPHAADSFNVSYIQMKNAGTCSYSVVITTSCSSPRYTRDQISISFGDAYGNQIYAPRLDDPASGTFESCSSDTFQITGPCAYQICYVYLYRSGLDGWKPESVKINGYNGRPVTFYYNTYIPRDTWYGFNLCNGASSSSSYQVSMQKWLIFMVLGFVLSCWL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo