SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g28890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g28890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g28890

Feature Type:gene_model
Chromosome:Gm20
Start:37838081
stop:37839638
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G22840AT Annotation by Michelle Graham. TAIR10: Chlorophyll A-B binding family protein | chr3:8084628-8085445 REVERSE LENGTH=195 SoyBaseE_val: 1.00E-67ISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009411GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV SoyBaseN/AISS
GO:0009718GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016168GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding SoyBaseN/AISS
PTHR14154Panther UPF0041 BRAIN PROTEIN 44-RELATED JGI ISS
PTHR14154:SF1Panther UNCHARACTERIZED JGI ISS
PF00504PFAM Chlorophyll A-B binding protein JGI ISS
UniRef100_I1NGK2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NGK2_SOYBN SoyBaseE_val: 6.00E-133ISS
UniRef100_P93169UniRef Annotation by Michelle Graham. Most informative UniRef hit: Early light-induced protein n=1 Tax=Glycine max RepID=P93169_SOYBN SoyBaseE_val: 9.00E-131ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g28890 not represented in the dataset

Glyma20g28890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g38910 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g150600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g28890.1   sequence type=CDS   gene model=Glyma20g28890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCCTCTTCTTATGCTATGCAATCAATCCTGGCAAACCCTTTGATCCGCATTTCCAGCGGGTCTAGGGTGAACCAATTTGGCGTTCCTGCTTTGCACATGAGAAGGAATGTTGGCCTGAGAGTTAGGTCCATGGCTAAGGAAGAACAACCAAGTGAGCCTGCAACCCCAGTTACACCGCCACCATCAGTAGAACCCAAGCCACAGCCAGTCTCTGCTCCTTCACCAAAGGTGAGCACTAAGTTTTCTGATGTGTTGGCATTCAGTGGGCCAGCACCTGAGAGGATCAATGGAAGGTTGGCCATGATTGGGTTTGTGGCTGCAATGGCAGTGGAAGTAGCCAAAGGGCAAGGTGTGTTAGAACAAATATCCAATGGTGGCATCCCATGGTTCTTGGGGACAAGTGTGGTCCTTACCCTTGCTTCCTTGATTCCACTCTTCCAAGGTGTCAGCGTGGAGTCTAAGTCCAAAGGGTTCATGTCCTCAGATGCAGAACTGTGGAATGGGAGATTTGCTATGTTGGGTTTGATTGCTCTGGCTTTTACTGAGTATGTTAAGGGTAGTACTTTGGTATAA

>Glyma20g28890.1   sequence type=predicted peptide   gene model=Glyma20g28890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAASSYAMQSILANPLIRISSGSRVNQFGVPALHMRRNVGLRVRSMAKEEQPSEPATPVTPPPSVEPKPQPVSAPSPKVSTKFSDVLAFSGPAPERINGRLAMIGFVAAMAVEVAKGQGVLEQISNGGIPWFLGTSVVLTLASLIPLFQGVSVESKSKGFMSSDAELWNGRFAMLGLIALAFTEYVKGSTLV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo