Glyma20g27361 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g27361): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g27361): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g27361

Feature Type:	gene_model
Chromosome:	Gm20
Start:	36550845
stop:	36552588
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g27361

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G24840	AT	Annotation by Michelle Graham. TAIR10: AGAMOUS-like 61 \| chr2:10581082-10581876 FORWARD LENGTH=264	SoyBase	E_val: 3.00E-37	ISS
GO:0009559	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac central cell differentiation	SoyBase	N/A	ISS
GO:0009612	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus	SoyBase	N/A	ISS
GO:0019722	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0043078	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: polar nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
KOG0014	KOG	MADS box transcription factor	JGI		ISS
PTHR11945	Panther	MADS BOX PROTEIN	JGI		ISS
PTHR11945:SF19	Panther	MADS BOX PROTEIN	JGI		ISS
PF00319	PFAM	SRF-type transcription factor (DNA-binding and dimerisation domain)	JGI		ISS
UniRef100_G7ZYX8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Myocyte-specific enhancer factor 2A n=1 Tax=Medicago truncatula RepID=G7ZYX8_MEDTR	SoyBase	E_val: 3.00E-65	ISS
UniRef100_UPI000233E066	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E066 related cluster n=1 Tax=unknown RepID=UPI000233E066	SoyBase	E_val: 3.00E-122	ISS

Expression Patterns of Glyma20g27361

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g27361 not represented in the dataset	Glyma20g27361 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g27361 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g136800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g27361

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g27361

Limit To All Plant Sequences

>Glyma20g27361.1   sequence type=CDS   gene model=Glyma20g27361   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATATGTTTAAGCAGAAGGAGAAGAAGAAAAACACAGGCCGCAAAAAGATTGAGATCAAGAAGCTTGACAAGGGTAGCAACAAGCAAGTGACGTTCTCAAAAAGAAGAGCAGGACTGTTCAAAAAAGCCAGCGAACTCTGCATTTTATGCAATGTTTATGTAGCCATAATTGTGTTTTCTCCTGCTGACAAATTGTTCTGCTTTGGCCATCCAGATATCGACAGCATAATTGGTCGCTATCTCAAAGGAGACAATGCAGAGTTTGAATCAGCAAAGTCGTCAAAAGGAAAATCAGTGTCATGTGAGGAACGTAACAGACAATATGAAGAGGCGATGAAGAAGTTGGAGTTGGAAAAGAAGAACTTGGCACAAATTGAAGTTTTGACTAAAGGTTGGAACAGAAGTTGGTGGGACGATCCCATTGATCAGATGACTGATCTGCAATTGGAACAGTTTATGGTGTCCATTTACGAGTTAAGGAAAAAACTAGCAGAAAGGGCAGGTGAATTGATGATCCACCGTCAGTCACCAACCTTCCTCCACTCTCCTGAACCGTCGTCTCCAAACAAAGGAAGCATTAAATATACTTTCTCTAGATAA

Predicted protein sequences of Glyma20g27361

Limit To All Plant Sequences

>Glyma20g27361.1   sequence type=predicted peptide   gene model=Glyma20g27361   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDMFKQKEKKKNTGRKKIEIKKLDKGSNKQVTFSKRRAGLFKKASELCILCNVYVAIIVFSPADKLFCFGHPDIDSIIGRYLKGDNAEFESAKSSKGKSVSCEERNRQYEEAMKKLELEKKNLAQIEVLTKGWNRSWWDDPIDQMTDLQLEQFMVSIYELRKKLAERAGELMIHRQSPTFLHSPEPSSPNKGSIKYTFSR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain