SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g26960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g26960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g26960

Feature Type:gene_model
Chromosome:Gm20
Start:36252728
stop:36255799
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G19590AT Annotation by Michelle Graham. TAIR10: Transducin/WD40 repeat-like superfamily protein | chr3:6805798-6808374 FORWARD LENGTH=340 SoyBaseE_val: 0ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0007094GO-bp Annotation by Michelle Graham. GO Biological Process: mitotic cell cycle spindle assembly checkpoint SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0000776GO-cc Annotation by Michelle Graham. GO Cellular Compartment: kinetochore SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009524GO-cc Annotation by Michelle Graham. GO Cellular Compartment: phragmoplast SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG1036 KOG Mitotic spindle checkpoint protein BUB3, WD repeat superfamily JGI ISS
PTHR10971Panther MITOTIC CHECKPOINT PROTEIN AND POLY(A)+ RNA EXPORT PROTEIN JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_B9SND5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitotic checkpoint protein bub3, putative n=1 Tax=Ricinus communis RepID=B9SND5_RICCO SoyBaseE_val: 0ISS
UniRef100_C6TK27UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TK27_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g26960 not represented in the dataset

Glyma20g26960 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g133400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g26960.1   sequence type=CDS   gene model=Glyma20g26960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTACGGCGGTGCTCACGACGGGGCGAGAGTTGTCGAACCCTCCATCCGACGGCATCACCAATCTTCGATTCTCCAACCACAGCGATCATCTTTTGGTGTCCTCATGGGACAAGAGCGTGCGCTTGTATGATGCGAGTGCCAATGTGTTGAGAGGAGAGTTTATGCACGCTGGCCCCGTCCTCGATTGCTGCTTCCACGACGATTCCTCCGGCTTCAGTGCCGCCGCCGACAACACTGTTAGACGGCTTGTCTTCAGCTCTAATAAAGAGGATATTCTGGGAAGGCATGATGCACCCGTTCGTTGCATTGAGTATTCATATGCTGCAGGGCAATTGATCACTGGTAGTTGGGACAAAACCCTAAAATGTTGGGACCCTAGAGGTGCAAGTGGCCAAGAGCGCACACTTGTTGGGACATATCCACAACCTGAGCGTGTCTACTCTCTCTCACTGGTTGGACATCGCCTGGTTGTAGCAACAGCTGGAAGACATGTTAATATCTATGATTTGAGAAACATGTCTCAACCGGAACAAAGAAGAGAATCCTCACTGAAATACCAAACCAGATGTGTGCGCTGTTACCCAAATGGAACAGGATATGCACTTAGTTCTGTTGAAGGGCGGGTTGCTATGGAATTCTTCGACCTCTCAGAGGCTAGCCAAGCAAAAAAATATGCTTTTAAGTGTCACAGAAAATCAGAGGCTGGAAGGGACATAGTCTATCCTGTGAATGCAATTGCTTTCCACCCCATATATGGAACATTTGCCACAGGAGGTTGTGACGGGTATGTTAACGTGTGGGACGGAAACAATAAGAAGAGGCTATACCAGTACTCAAAATATCCTACCAGCATTGCTGCACTGTCGTTTAGCAGAGATGGACGCCTCTTGGCTGTTGCATCAAGTTACACATTCGAAGAAGGGCCTAAAGCAGGAACTAAAGCCGACGAACAAGATGCTATCTACGTACGCAGTGTAAACGAGATTGAGGTCAAGCCGAAGCCCAAAGTATATCCCAATCCTCCAGCTTGA

>Glyma20g26960.1   sequence type=predicted peptide   gene model=Glyma20g26960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATAVLTTGRELSNPPSDGITNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHAGPVLDCCFHDDSSGFSAAADNTVRRLVFSSNKEDILGRHDAPVRCIEYSYAAGQLITGSWDKTLKCWDPRGASGQERTLVGTYPQPERVYSLSLVGHRLVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGYVNVWDGNNKKRLYQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGPKAGTKADEQDAIYVRSVNEIEVKPKPKVYPNPPA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo