Glyma20g26370 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g26370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g26370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g26370

Feature Type:	gene_model
Chromosome:	Gm20
Start:	35853402
stop:	35856305
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g26370

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G34190	AT	Annotation by Michelle Graham. TAIR10: stress enhanced protein 1 \| chr4:16372606-16373511 REVERSE LENGTH=146	SoyBase	E_val: 3.00E-46	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0009637	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to blue light	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009773	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I	SoyBase	N/A	ISS
GO:0010114	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to red light	SoyBase	N/A	ISS
GO:0010155	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of proton transport	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0010218	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to far red light	SoyBase	N/A	ISS
GO:0015995	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0016168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding	SoyBase	N/A	ISS
UniRef100_B9HS51	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Stress-enhanced protein 1 n=1 Tax=Populus trichocarpa RepID=B9HS51_POPTR	SoyBase	E_val: 3.00E-46	ISS
UniRef100_I1NFW4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NFW4_SOYBN	SoyBase	E_val: 1.00E-96	ISS

Expression Patterns of Glyma20g26370

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g26370 not represented in the dataset	Glyma20g26370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g26370

Paralog	Evidence	Comments
Glyma10g40930	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g26370 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g127500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g26370

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma20g26370

Limit To All Plant Sequences

>Glyma20g26370.2   sequence type=transcript   gene model=Glyma20g26370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAATCATTAAAGAGGCCACGTGGGACTTAAGGAGTGTGAATGAAGGGTTATGGTGGAACAAGTTTGAGGCACTGACACCGCTTGAGCAAAAGCAGGAGATAAACATTAAACACTGCAAAATTCGTAGGAACCGCACAATTGAGATAGTTGCAACCAGCAAGTCACCACCATGGCACTTGTTGAAGCCTCTGCTTCTCTTTCAATCTCTTCTGTTGCTCGTCTTTTCACTCCACCAAAATGCTCTCCCACCGCTCACTTTCCTCATCGGAATTTTGTTGCAACTCGACCATCATTCATCGCTGGTTCCCCACTCTTGATTCGGAGAAATCATGGAAGGAAAGCTGCATGCAAAGCAATGCCTGTTACAATAAGATGTGAGCAAAGTACCCAGGAAGGGAACAGTTTGGATGTGTGGCTAGGTCGGCTAGCCATGGTTGGCTTTGCAGTAGCAATCACTGTTGAAATTGCTACTGGGAAGGGACTCCTAGAGAACTTTGGACTCACAAGTCCACTGCCTACAGTTGCCCTTGCAGTAACAGCACTTGTGGGTGTCTTGACGGCAGTTTTTATCTTCCAGTCAGCGTCAAAAAATTGATCACATATTCCAACTCCTTGTGTCTGTTGTAAATTCTGAAGCTCAGAGATTTCATTTTCGGAGATAAAATTTTATCATTCTTTTCTGTAATATTTGTTTTGATGAAAAGAATTGGCAATGAAGCCTGAAAAATCAAAGTAACTTCGTGTTAAATATGGTATGACCTCACCTTTCCATGTTGCCTTCATCCATGTCAAACGCTACCTTTGTGAATTATGTTGTCCTCATTGCATTAGTTGTGAATGAAAGAGGATTTTCACTTAATATCGTGAAGAGTTTGCGATAAGCATAATGCATTACTCACAACTAAAATTGGCACGGAAGAATAT

Coding sequences of Glyma20g26370

Limit To All Plant Sequences

>Glyma20g26370.1   sequence type=CDS   gene model=Glyma20g26370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACTTGTTGAAGCCTCTGCTTCTCTTTCAATCTCTTCTGGTGTTGCTCGTCTTTTCACTCCACCAAAATGCTCTCCCACCGCTCACTTTCCTCATCGGAATTTTGTTGCAACTCGACCATCATTCATCGCTGGTTCCCCACTCTTGATTCGGAGAAATCATGGAAGGAAAGCTGCATGCAAAGCAATGCCTGTTACAATAAGATGTGAGCAAAGTACCCAGGAAGGGAACAGTTTGGATGTGTGGCTAGGTCGGCTAGCCATGGTTGGCTTTGCAGTAGCAATCACTGTTGAAATTGCTACTGGGAAGGGACTCCTAGAGAACTTTGGACTCACAAGTCCACTGCCTACAGTTGCCCTTGCAGTAACAGCACTTGTGGGTGTCTTGACGGCAGTTTTTATCTTCCAGTCAGCGTCAAAAAATTGA

>Glyma20g26370.2   sequence type=CDS   gene model=Glyma20g26370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACTTGTTGAAGCCTCTGCTTCTCTTTCAATCTCTTCTGTTGCTCGTCTTTTCACTCCACCAAAATGCTCTCCCACCGCTCACTTTCCTCATCGGAATTTTGTTGCAACTCGACCATCATTCATCGCTGGTTCCCCACTCTTGATTCGGAGAAATCATGGAAGGAAAGCTGCATGCAAAGCAATGCCTGTTACAATAAGATGTGAGCAAAGTACCCAGGAAGGGAACAGTTTGGATGTGTGGCTAGGTCGGCTAGCCATGGTTGGCTTTGCAGTAGCAATCACTGTTGAAATTGCTACTGGGAAGGGACTCCTAGAGAACTTTGGACTCACAAGTCCACTGCCTACAGTTGCCCTTGCAGTAACAGCACTTGTGGGTGTCTTGACGGCAGTTTTTATCTTCCAGTCAGCGTCAAAAAATTGA

Predicted protein sequences of Glyma20g26370

Limit To All Plant Sequences

>Glyma20g26370.1   sequence type=predicted peptide   gene model=Glyma20g26370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALVEASASLSISSGVARLFTPPKCSPTAHFPHRNFVATRPSFIAGSPLLIRRNHGRKAACKAMPVTIRCEQSTQEGNSLDVWLGRLAMVGFAVAITVEIATGKGLLENFGLTSPLPTVALAVTALVGVLTAVFIFQSASKN*

>Glyma20g26370.2   sequence type=predicted peptide   gene model=Glyma20g26370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALVEASASLSISSVARLFTPPKCSPTAHFPHRNFVATRPSFIAGSPLLIRRNHGRKAACKAMPVTIRCEQSTQEGNSLDVWLGRLAMVGFAVAITVEIATGKGLLENFGLTSPLPTVALAVTALVGVLTAVFIFQSASKN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain