Glyma20g25070 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g25070

Feature Type:	gene_model
Chromosome:	Gm20
Start:	34788057
stop:	34788976
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g25070

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G68450	AT	Annotation by Michelle Graham. TAIR10: VQ motif-containing protein \| chr1:25661721-25662179 REVERSE LENGTH=152	SoyBase	E_val: 7.00E-11	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF05678	PFAM	VQ motif	JGI		ISS
UniRef100_G7ID96	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein MKS1 n=1 Tax=Medicago truncatula RepID=G7ID96_MEDTR	SoyBase	E_val: 1.00E-47	ISS
UniRef100_I1NFK2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1NFK2_SOYBN	SoyBase	E_val: 9.00E-110	ISS

Proteins Associated with Glyma20g25070

Locus	Gene Symbol	Protein Name
	VQ74	VQ motif containing protein gene 74

Expression Patterns of Glyma20g25070

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g25070

Paralog	Evidence	Comments
Glyma10g41970	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g25070 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g116600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g25070

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g25070

Limit To All Plant Sequences

>Glyma20g25070.2   sequence type=CDS   gene model=Glyma20g25070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATACGCAAAGAAACCAAACTCCAAAGGCCACAGAGGATTAATCCCATCATCATTTACACCGAATCTCCCAAGGTTATCCACACCAAGGCCAAAGATTTCATGGCTCTTGTTCAAAGACTCACGGGTAGGTCAAGCACCAATGATAATTTGTCCACTACTGCTTCACTTCCTCAAGAGGGTTCTGAGAATTTTGGCTCATCTTTATCTGATGGGTCAAACTACAATAGCAATGAAACAAGCTCGGCTCTTAGGAGATTTGGTGAGAATTTGGTTGAGAGTGGTGCAATTATTCAACATGGTCCCTCTCATCTGGATTTTGTTGACATGCCACTTTCTACTCCAAATTCCTCAGATTTCTTTTGCTCTTCTCGATCATCAGTGTATAAATATTCTGATTCTCCATATGGGGTTTTGGGAAGTTTGATATCCCCTTCCGGGTTGGAATTCATGAAAGAGTTGCCTGAATATTGA

Predicted protein sequences of Glyma20g25070

Limit To All Plant Sequences

>Glyma20g25070.2   sequence type=predicted peptide   gene model=Glyma20g25070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIRKETKLQRPQRINPIIIYTESPKVIHTKAKDFMALVQRLTGRSSTNDNLSTTASLPQEGSENFGSSLSDGSNYNSNETSSALRRFGENLVESGAIIQHGPSHLDFVDMPLSTPNSSDFFCSSRSSVYKYSDSPYGVLGSLISPSGLEFMKELPEY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain