SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g24840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g24840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g24840

Feature Type:gene_model
Chromosome:Gm20
Start:34488163
stop:34491196
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G39670AT Annotation by Michelle Graham. TAIR10: Glycolipid transfer protein (GLTP) family protein | chr4:18410172-18410861 FORWARD LENGTH=229 SoyBaseE_val: 7.00E-96ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006984GO-bp Annotation by Michelle Graham. GO Biological Process: ER-nucleus signaling pathway SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0046836GO-bp Annotation by Michelle Graham. GO Biological Process: glycolipid transport SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0052542GO-bp Annotation by Michelle Graham. GO Biological Process: defense response by callose deposition SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0017089GO-mf Annotation by Michelle Graham. GO Molecular Function: glycolipid transporter activity SoyBaseN/AISS
GO:0051861GO-mf Annotation by Michelle Graham. GO Molecular Function: glycolipid binding SoyBaseN/AISS
KOG4189 KOG Uncharacterized conserved protein JGI ISS
PTHR10219Panther GLYCOLIPID TRANSFER PROTEIN-RELATED JGI ISS
PTHR10219:SF4Panther HET-C JGI ISS
PF08718PFAM Glycolipid transfer protein (GLTP) JGI ISS
UniRef100_C6T607UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T607_SOYBN SoyBaseE_val: 3.00E-150ISS
UniRef100_Q8L7U7UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT4g39670/T19P19_60 n=1 Tax=Arabidopsis thaliana RepID=Q8L7U7_ARATH SoyBaseE_val: 3.00E-93ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g24840 not represented in the dataset

Glyma20g24840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g42190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g114600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g24840.1   sequence type=CDS   gene model=Glyma20g24840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCGAGATGGATGAGCGCGTGGTTATACAGCAACCTCTTTCGGCCATAGCAGAGACGTTTGAGGAACTTTCCAAGAGGAACAACGCCAACGAGATTCGCTTGGACACTTTCTGCCAGGCTGCGTCTCTCGTCTCCGTTCTCTTCCGTTCTCTCGGTCTCGCTTTCAAATTCGCTGAATTGGAATACGTCGCCAAGCTACATGGACTATTGGAAGCATCAAAGACATGTTCCACTCTACCGGATATTCTTAACCTTGATGTCGCCAGTGACACAGTGAAAACATCCGGAAGTTTTTCACGTAATCTGCGTAGAGTTCGGCAGGGTCTTGATCTTGTCAGAGCTATATTCGAACAACTTTTGTCAACTGATGATAGTTCTCTAAAAGAAGTGGCTTCAACCGCTTACGGACAAGTTTGTGCCCCATATCACACATGGGCAGTAAGAACAGCTGTATATGCTGGGATGTATACACTTCCAACGAGAGATCAACTTTTGATGAAGCTCAATGAAACAGAGCAATCAGCTGACAAGAAGATGAGAAGGTACATTGCTGCCTCGCTTCCAATTATAGAATACATTGATAAACTGTACCTTGCTCGAAATATTACGTTGGACTGGTGA

>Glyma20g24840.1   sequence type=predicted peptide   gene model=Glyma20g24840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPEMDERVVIQQPLSAIAETFEELSKRNNANEIRLDTFCQAASLVSVLFRSLGLAFKFAELEYVAKLHGLLEASKTCSTLPDILNLDVASDTVKTSGSFSRNLRRVRQGLDLVRAIFEQLLSTDDSSLKEVASTAYGQVCAPYHTWAVRTAVYAGMYTLPTRDQLLMKLNETEQSADKKMRRYIAASLPIIEYIDKLYLARNITLDW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo