SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g24810

Feature Type:gene_model
Chromosome:Gm20
Start:34452632
stop:34454918
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g24810
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30490AT Annotation by Michelle Graham. TAIR10: cinnamate-4-hydroxylase | chr2:12993861-12995683 REVERSE LENGTH=505 SoyBaseE_val: 0ISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009698GO-bp Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process SoyBaseN/AISS
GO:0009699GO-bp Annotation by Michelle Graham. GO Biological Process: phenylpropanoid biosynthetic process SoyBaseN/AISS
GO:0009805GO-bp Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process SoyBaseN/AISS
GO:0009808GO-bp Annotation by Michelle Graham. GO Biological Process: lignin metabolic process SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0032502GO-bp Annotation by Michelle Graham. GO Biological Process: developmental process SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016705GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen SoyBaseN/AISS
GO:0016710GO-mf Annotation by Michelle Graham. GO Molecular Function: trans-cinnamate 4-monooxygenase activity SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
KOG0156 KOG Cytochrome P450 CYP2 subfamily JGI ISS
PTHR24298Panther FAMILY NOT NAMED JGI ISS
PTHR24298:SF44Panther JGI ISS
PF00067PFAM Cytochrome P450 JGI ISS
UniRef100_I1NFH1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NFH1_SOYBN SoyBaseE_val: 0ISS
UniRef100_O24315UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cinnamate 4-hydroxylase n=2 Tax=Phaseolus vulgaris RepID=O24315_PHAVU SoyBaseE_val: 0ISS

Expression Patterns of Glyma20g24810
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g24810
ParalogEvidenceComments
Glyma10g42230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g24810 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g114200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g24810
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g24810
>Glyma20g24810.1   sequence type=CDS   gene model=Glyma20g24810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCTTCAAATCAAGGAACCGCTCCTTTTCACTCTTGTAACAATATCACTTATTTCAATTACAAAACTCTTGCATTCTTATTTTTCTATACCTTTCTCTCCATCCAATCTTTCCATTGCTATTGCCACCCTCATTTTTGTTCTAATCTCATACAAATTTTCCTCATCCTCTATAAAACACTCTTCCACTACTCTGCCCCCAGGTCCTCTATCTGTTCCAATATTTGGTAACTGGCTACAAGTTGGCAATGACCTTAACCACCGTCTTCTAGCATCAATGTCTCAAACCTATGGTCCCGTGTTCCTACTCAAACTAGGTTCCAAAAACTTGGTCGTGGTCTCTGACCCCGAGCTTGCCACCCAAGTGCTCCACGCACAAGGCGTAGAATTTGGCTCTCGCCCACGGAACGTTGTGTTTGATATCTTCACGGGGAATGGCCAAGACATGGTTTTCACCGTCTACGGCGACCACTGGCGCAAAATGCGAAGAATAATGACACTGCCATTCTTCACCAACAAGGTTGTCCACAATTACAGCAACATGTGGGAGGAGGAGATGGACTTGGTGGTGCGTGACCTCAACGTGAATGAGAGGGTGAGGAGCGAAGGGATAGTTATCAGAAGGCGGCTTCAGCTGATGCTGTACAATATCATGTATAGGATGATGTTTGATGCCAAGTTTGAGTCTCAAGAAGACCCTTTGTTCATTCAGGCCACCAGGTTTAACTCCGAGAGAAGCCGTTTGGCGCAGAGTTTTGAATACAATTACGGGGATTTTATACCCTTGCTCCGGCCATTCTTGAGAGGGTACCTCAACAAGTGCAAGGACTTGCAGTCTAGGAGGTTGGCATTTTTCAACACCCACTACGTTGAGAAAAGAAGACAAATAATGGCTGCCAATGGGGAGAAGCACAAGATCAGCTGTGCAATGGATCACATCATAGATGCTCAGATGAAGGGAGAAATCAGCGAAGAGAATGTGATCTACATAGTAGAAAACATCAACGTTGCAGCAATTGAGACAACACTATGGTCCATAGAGTGGGCAGTAGCAGAGTTGGTGAACCATCCAACCGTCCAAAGCAAGATTCGTGATGAGATATCAAAAGTGCTAAAAGGGGAGCCAGTTACAGAATCCAACCTACACGAGCTACCATACTTACAAGCCACGGTGAAAGAGACACTGAGACTTCACACCCCAATTCCTCTTCTGGTGCCCCACATGAACCTGGAAGAAGCAAAGCTAGGAGGGCACACTGTTCCAAAAGAGTCAAAGGTGGTGGTGAATGCTTGGTGGCTTGCCAACAACCCTTCATGGTGGAAGAACCCAGAGGAGTTCAGGCCAGAAAGGTTCTTGGAAGAGGAATGTGCAACAGATGCAGTTGCAGGAGGAAAAGTTGACTTTAGGTTCGTGCCATTTGGTGTGGGAAGGAGGAGTTGCCCTGGGATCATACTTGCATTGCCAATACTGGGGCTTGTGATTGCAAAGTTGGTGAAAAGTTTTCAGATGAGTGCTCCAGCGGGGACAAAGATTGATGTGAGTGAAAAAGGAGGGCAATTCAGCTTGCACATTGCCAACCACTCCACTGTGTTGTTCCATCCAATTAAGACACTATGA
Predicted protein sequences of Glyma20g24810
>Glyma20g24810.1   sequence type=predicted peptide   gene model=Glyma20g24810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLQIKEPLLFTLVTISLISITKLLHSYFSIPFSPSNLSIAIATLIFVLISYKFSSSSIKHSSTTLPPGPLSVPIFGNWLQVGNDLNHRLLASMSQTYGPVFLLKLGSKNLVVVSDPELATQVLHAQGVEFGSRPRNVVFDIFTGNGQDMVFTVYGDHWRKMRRIMTLPFFTNKVVHNYSNMWEEEMDLVVRDLNVNERVRSEGIVIRRRLQLMLYNIMYRMMFDAKFESQEDPLFIQATRFNSERSRLAQSFEYNYGDFIPLLRPFLRGYLNKCKDLQSRRLAFFNTHYVEKRRQIMAANGEKHKISCAMDHIIDAQMKGEISEENVIYIVENINVAAIETTLWSIEWAVAELVNHPTVQSKIRDEISKVLKGEPVTESNLHELPYLQATVKETLRLHTPIPLLVPHMNLEEAKLGGHTVPKESKVVVNAWWLANNPSWWKNPEEFRPERFLEEECATDAVAGGKVDFRFVPFGVGRRSCPGIILALPILGLVIAKLVKSFQMSAPAGTKIDVSEKGGQFSLHIANHSTVLFHPIKTL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo