SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g24500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g24500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g24500

Feature Type:gene_model
Chromosome:Gm20
Start:34160319
stop:34162559
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g24500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G27510AT Annotation by Michelle Graham. TAIR10: ferredoxin 3 | chr2:11758281-11758748 REVERSE LENGTH=155 SoyBaseE_val: 3.00E-58ISS
GO:0009688GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid biosynthetic process SoyBaseN/AISS
GO:0022900GO-bp Annotation by Michelle Graham. GO Biological Process: electron transport chain SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0051536GO-mf Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding SoyBaseN/AISS
GO:0051537GO-mf Annotation by Michelle Graham. GO Molecular Function: 2 iron, 2 sulfur cluster binding SoyBaseN/AISS
PF00111PFAM 2Fe-2S iron-sulfur cluster binding domain JGI ISS
UniRef100_B9RPT1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ferredoxin-3, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9RPT1_RICCO SoyBaseE_val: 4.00E-74ISS
UniRef100_C6T265UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T265_SOYBN SoyBaseE_val: 6.00E-109ISS

Expression Patterns of Glyma20g24500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g24500 not represented in the dataset
Glyma20g24500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g24500
ParalogEvidenceComments
Glyma10g42540 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g24500 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g110800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g24500
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g24500
>Glyma20g24500.1   sequence type=CDS   gene model=Glyma20g24500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGCAGTGAACATGTCCACTATGAGACTTCCAAGAGCTTCCTTGTCTGGAACAACACCAGCTAGGAGATCATGTGCTCTTACAAAGAGTCCATCATCTTTGAGGTCTGTGAAGAATGTGTCTAAAGTGTTTGGATTGAAATCATCTTCCTTTAGAGTGTCAGCAATGGCGGTATATAAAGTGAAGCTGATTGGACCGGACGGTGAAGAGAATGAATTTGAAGCCCCTGATGACACTTACATTCTGGATTCGGCTGAAAATGCTGGAGTGGAGCTACCTTACTCATGCAGAGCTGGTGCCTGCTCTACTTGTGCTGGCCAAGTTGTTTCAGGCTCTGTGGATCAGGCAGATCAATCCTTTCTTGATGACCATCAAATTGAAAAGGGTTACCTTCTGACATGTGTCTCATACCCGAAATCAGATTGTGTGATTCACACCCACAAGGAGGAAGATCTCGTCTAG
Predicted protein sequences of Glyma20g24500
>Glyma20g24500.1   sequence type=predicted peptide   gene model=Glyma20g24500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSAVNMSTMRLPRASLSGTTPARRSCALTKSPSSLRSVKNVSKVFGLKSSSFRVSAMAVYKVKLIGPDGEENEFEAPDDTYILDSAENAGVELPYSCRAGACSTCAGQVVSGSVDQADQSFLDDHQIEKGYLLTCVSYPKSDCVIHTHKEEDLV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo