SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g23920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g23920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g23920

Feature Type:gene_model
Chromosome:Gm20
Start:33667442
stop:33671411
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40820AT Annotation by Michelle Graham. TAIR10: Ataxia telangiectasia-mutated and RAD3-related | chr5:16343860-16353847 REVERSE LENGTH=2702 SoyBaseE_val: 2.00E-40ISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0006310GO-bp Annotation by Michelle Graham. GO Biological Process: DNA recombination SoyBaseN/AISS
GO:0007004GO-bp Annotation by Michelle Graham. GO Biological Process: telomere maintenance via telomerase SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0010044GO-bp Annotation by Michelle Graham. GO Biological Process: response to aluminum ion SoyBaseN/AISS
GO:0010332GO-bp Annotation by Michelle Graham. GO Biological Process: response to gamma radiation SoyBaseN/AISS
GO:0032204GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of telomere maintenance SoyBaseN/AISS
GO:0032504GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organism reproduction SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0043247GO-bp Annotation by Michelle Graham. GO Biological Process: telomere maintenance in response to DNA damage SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
GO:0016773GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, alcohol group as acceptor SoyBaseN/AISS
UniRef100_G7IDC1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine protein kinase ATR n=1 Tax=Medicago truncatula RepID=G7IDC1_MEDTR SoyBaseE_val: 6.00E-56ISS
UniRef100_UPI000233D21EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D21E related cluster n=1 Tax=unknown RepID=UPI000233D21E SoyBaseE_val: 1.00E-70ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g23920 not represented in the dataset

Glyma20g23920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g43040 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g23920.1   sequence type=CDS   gene model=Glyma20g23920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCTCGCCACGGTGTCTTCTTCGAAGCTCTCGGTTCTCTTCTCTCCTTGCTCCACTCCGGAGCACGAGATGCTTACCGCCAGTTTTTCGTCGATTCCATGTCGCTCATTCAAGATATTCTATACGTGTCTTCACTCAGTGTTAATGGATCCTCCAGGTCCAGGGTGACGCTCAAGTGTTTTTCCGATTCCTTCTCTGGAGTTGAAGACCTTCCATCCACCAACAGGCCCGTCGATGGACGTGGTTTATTGATTGACCTCACCGCCCCAACCAGATGGCAACCCTTTGCAACTTGGATTTTGAAGCTTGTCTGTAAAAGTCTAACTGAAGGAACACTCTATGTTGAGGGATTGATCCGTGCGTCCTTTATTTCTGCTGCGTGTTCTCTTTTATGCTATGGGAATGCTGACCTGCATATGGTACACACTTTTACTTCAACAACAACAACAACAACGCCTTATCCCACTAGTTTGACTGGCTACTCTCCCTTGCATGGCGAAATCGCCAATGGGGCTGGCGATACCAAGGAACCTGTCAGTGGCAGTGGCGTCTTTGCCATGTGTCACAGCCACAACAAACGCGCCAATGGGACTGACGGTTTGCATGGTTTTTGCATGCACTTTACGTAG

>Glyma20g23920.1   sequence type=predicted peptide   gene model=Glyma20g23920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SRHGVFFEALGSLLSLLHSGARDAYRQFFVDSMSLIQDILYVSSLSVNGSSRSRVTLKCFSDSFSGVEDLPSTNRPVDGRGLLIDLTAPTRWQPFATWILKLVCKSLTEGTLYVEGLIRASFISAACSLLCYGNADLHMVHTFTSTTTTTTPYPTSLTGYSPLHGEIANGAGDTKEPVSGSGVFAMCHSHNKRANGTDGLHGFCMHFT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo