|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G20090 | AT | Annotation by Michelle Graham. TAIR10: Uncharacterised protein family (UPF0041) | chr5:6787246-6788000 REVERSE LENGTH=110 | SoyBase | E_val: 4.00E-25 | ISS |
| GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
| GO:0006301 | GO-bp | Annotation by Michelle Graham. GO Biological Process: postreplication repair | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009060 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aerobic respiration | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| PTHR14154 | Panther | UPF0041 BRAIN PROTEIN 44-RELATED | JGI | ISS | |
| PTHR14154:SF3 | Panther | UNCHARACTERIZED | JGI | ISS | |
| PF03650 | PFAM | Uncharacterised protein family (UPF0041) | JGI | ISS | |
| UniRef100_B9RAJ4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Brain protein, putative n=1 Tax=Ricinus communis RepID=B9RAJ4_RICCO | SoyBase | E_val: 3.00E-24 | ISS |
| UniRef100_I1LF33 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LF33_SOYBN | SoyBase | E_val: 2.00E-26 | ISS |
|
Glyma20g23870 not represented in the dataset |
Glyma20g23870 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g23870.1 sequence type=CDS gene model=Glyma20g23870 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATCTCTGGCAACATGACAGGAGCAATGTGTGTCTATTCAGCATTGTTCATGAGATTCGCATGGATGGTACAGCCACGCAACTATCTAGTTTTTGCTTGTCATGCCTTAAACGAGACTGTTCAACTCTATCACTTCTCCCGATAG
>Glyma20g23870.1 sequence type=predicted peptide gene model=Glyma20g23870 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MISGNMTGAMCVYSALFMRFAWMVQPRNYLVFACHALNETVQLYHFSR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||