SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g23801): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g23801): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g23801

Feature Type:gene_model
Chromosome:Gm20
Start:33531267
stop:33532152
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g23801
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G49230AT Annotation by Michelle Graham. TAIR10: Drought-responsive family protein | chr5:19959048-19960422 REVERSE LENGTH=211 SoyBaseE_val: 6.00E-44ISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009785GO-bp Annotation by Michelle Graham. GO Biological Process: blue light signaling pathway SoyBaseN/AISS
GO:0010161GO-bp Annotation by Michelle Graham. GO Biological Process: red light signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
PF05605PFAM Drought induced 19 protein (Di19) JGI ISS
UniRef100_E3T7S4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dehydration-induced 19-like protein n=1 Tax=Gossypium hirsutum RepID=E3T7S4_GOSHI SoyBaseE_val: 8.00E-44ISS
UniRef100_UPI000233EA68UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EA68 related cluster n=1 Tax=unknown RepID=UPI000233EA68 SoyBaseE_val: 1.00E-106ISS

Expression Patterns of Glyma20g23801
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g23801 not represented in the dataset
Glyma20g23801 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g23801 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g104400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g23801
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g23801
>Glyma20g23801.1   sequence type=CDS   gene model=Glyma20g23801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGCAGAAAAGGGTGTAGAGATGGTGGCATTGGAGTGTTTGGGAAAAGGGTTCAATTTGGCCAGCAATTTTTGGTTGAAGTTCGCAAAGGGAATTTGTGAAGAGAGGTTGGTGGTGCTTGATGAACAGAACAAGAGGGATATTTTGATTCCTGGAACTGGAGGAGTTACCATTAAAGGGGTTTCTGAGAATATTCGTTGTGATAAAGGGGATTACGACGTCGTTTCCCTCTGTTGCCACATTGACGACCACCACCCTGTCCAAGCCAAAATCGGGGTGTGTCCCATTTGTGGGAAGAAGGTGGGATTGGATCTCGTTGGACATATTACTATGCAACATGGGAACTTCTTGAGGGTGCAGCGTAAAAGGAGGGTCAAGAAAGTAGGCTCTGGTTCAACAATGTCTATATTGAGAAAAGAGTTACGAGAAGGAGCCTTGCAGTCCCTTCTTGGAGGTTCTTCATACTTAGCTTCCTCCAATTCTGAGCCTGATCCTCTGTTATCATCTTTCATGTTTAACCCAGCTGTAACTGATGATTCTGCGAGTGCAAAACCTCCTTCTGTTGAAGATACTCTAGTAAAAGAAAGCCTATTTAGGGTTAGGGATTTGTAA
Predicted protein sequences of Glyma20g23801
>Glyma20g23801.1   sequence type=predicted peptide   gene model=Glyma20g23801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAEKGVEMVALECLGKGFNLASNFWLKFAKGICEERLVVLDEQNKRDILIPGTGGVTIKGVSENIRCDKGDYDVVSLCCHIDDHHPVQAKIGVCPICGKKVGLDLVGHITMQHGNFLRVQRKRRVKKVGSGSTMSILRKELREGALQSLLGGSSYLASSNSEPDPLLSSFMFNPAVTDDSASAKPPSVEDTLVKESLFRVRDL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo