Glyma20g23610 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g23610): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g23610): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g23610

Feature Type:	gene_model
Chromosome:	Gm20
Start:	33432250
stop:	33432453
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g23610

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G23180	AT	Annotation by Michelle Graham. TAIR10: cysteine-rich RLK (RECEPTOR-like protein kinase) 10 \| chr4:12138171-12140780 FORWARD LENGTH=669	SoyBase	E_val: 6.00E-14	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0006995	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to nitrogen starvation	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0004713	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF703	Panther		JGI		ISS
UniRef100_B9P6Y2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9P6Y2_POPTR	SoyBase	E_val: 6.00E-17	ISS
UniRef100_B9SSC0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9SSC0_RICCO	SoyBase	E_val: 3.00E-15	ISS

Expression Patterns of Glyma20g23610

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g23610 not represented in the dataset	Glyma20g23610 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g23610 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g23610

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g23610

Limit To All Plant Sequences

>Glyma20g23610.1   sequence type=CDS   gene model=Glyma20g23610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCATGGGCTTTGTGGTTAGAAGGCAGGCCTTCAGAATTGATTACTCTGCGCTGCATCCATATCAGTCTTATGTGTCTGCAACAGCATCCACATGACAGGCCAAACATGTCATCTGTAGTTATGATGTTAGGTAGTGAAATTGGCTTGCCTCTGCCCAAACTACCAGTT

Predicted protein sequences of Glyma20g23610

Limit To All Plant Sequences

>Glyma20g23610.1   sequence type=predicted peptide   gene model=Glyma20g23610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AWALWLEGRPSELITLRCIHISLMCLQQHPHDRPNMSSVVMMLGSEIGLPLPKLPV

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain