|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G23180 | AT | Annotation by Michelle Graham. TAIR10: cysteine-rich RLK (RECEPTOR-like protein kinase) 10 | chr4:12138171-12140780 FORWARD LENGTH=669 | SoyBase | E_val: 6.00E-14 | ISS |
| GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
| GO:0006995 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to nitrogen starvation | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
| GO:0004674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity | SoyBase | N/A | ISS |
| GO:0004713 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
| GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
| PTHR24420 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24420:SF703 | Panther | JGI | ISS | ||
| UniRef100_B9P6Y2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9P6Y2_POPTR | SoyBase | E_val: 6.00E-17 | ISS |
| UniRef100_B9SSC0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9SSC0_RICCO | SoyBase | E_val: 3.00E-15 | ISS |
|
Glyma20g23610 not represented in the dataset |
Glyma20g23610 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g23610.1 sequence type=CDS gene model=Glyma20g23610 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GCATGGGCTTTGTGGTTAGAAGGCAGGCCTTCAGAATTGATTACTCTGCGCTGCATCCATATCAGTCTTATGTGTCTGCAACAGCATCCACATGACAGGCCAAACATGTCATCTGTAGTTATGATGTTAGGTAGTGAAATTGGCTTGCCTCTGCCCAAACTACCAGTT
>Glyma20g23610.1 sequence type=predicted peptide gene model=Glyma20g23610 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high AWALWLEGRPSELITLRCIHISLMCLQQHPHDRPNMSSVVMMLGSEIGLPLPKLPV
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||