SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma20g22611

Feature Type:gene_model
Chromosome:Gm20
Start:32551616
stop:32552480
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G26749AT Annotation by Michelle Graham. TAIR10: C2H2 and C2HC zinc fingers superfamily protein | chr5:9398285-9399239 REVERSE LENGTH=147 SoyBaseE_val: 2.00E-19ISS
PF00642PFAM Zinc finger C-x8-C-x5-C-x3-H type (and similar) JGI ISS
UniRef100_Q0JP11UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger CCCH domain-containing protein 3 n=3 Tax=Oryza sativa RepID=C3H3_ORYSJ SoyBaseE_val: 4.00E-22ISS
UniRef100_UPI000233EECAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EECA related cluster n=1 Tax=unknown RepID=UPI000233EECA SoyBaseE_val: 1.00E-112ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g22611 not represented in the dataset

Glyma20g22611 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g28540 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g093700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g22611.1   sequence type=CDS   gene model=Glyma20g22611   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTGAAGAAGTGTTATTGCGAGAAGCAATTCCAAGACACAGCAGCGGATCGGAAACGGCACGTTCTGGGTATTCAACAGCAGCAGGCCAAAGCTCGCTGGTACGATTCCTTCAAACAGCAACAAATCCCTCCCGTTCCCAATCGATCCCTTTGCTTTCACTTCGTCAACACGGGATTTTGCCGTTACGGCGACTCTTGCAAATATCTCCATCCCATTCCCAACAACAATCTACAGCAGCCCCCAGTCCTAACCACACCGTCACCGTCACCGCCACCAGGGAATGTGGTAGGAGTTTCATTGGACAATCTTCCCCCCTTGCTTCAGCCTCCACCTGAAGGTGTATATCCCCACCTTCCCTTCTCGACTGGGGATAAATTTGTAATTCTACGCACCTCTCATTACTGCATCTCTGTGTCTGTGTTTAATCATTTTATTAGCCTTTTATTTCTTCCAATGTTCCTCCCTGTGTTCCCATGA

>Glyma20g22611.1   sequence type=predicted peptide   gene model=Glyma20g22611   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVKKCYCEKQFQDTAADRKRHVLGIQQQQAKARWYDSFKQQQIPPVPNRSLCFHFVNTGFCRYGDSCKYLHPIPNNNLQQPPVLTTPSPSPPPGNVVGVSLDNLPPLLQPPPEGVYPHLPFSTGDKFVILRTSHYCISVSVFNHFISLLFLPMFLPVFP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo