|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G43400 | AT | Annotation by Michelle Graham. TAIR10: electron-transfer flavoprotein:ubiquinone oxidoreductase | chr2:18021304-18025041 FORWARD LENGTH=633 | SoyBase | E_val: 1.00E-11 | ISS |
| GO:0006552 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leucine catabolic process | SoyBase | N/A | ISS |
| GO:0009228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thiamine biosynthetic process | SoyBase | N/A | ISS |
| GO:0009646 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to absence of light | SoyBase | N/A | ISS |
| GO:0019243 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005740 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial envelope | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0004174 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron-transferring-flavoprotein dehydrogenase activity | SoyBase | N/A | ISS |
| GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
| UniRef100_G7IHV7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Electron transfer flavoprotein-ubiquinone oxidoreductase n=1 Tax=Medicago truncatula RepID=G7IHV7_MEDTR | SoyBase | E_val: 2.00E-17 | ISS |
| UniRef100_G7IHV7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Electron transfer flavoprotein-ubiquinone oxidoreductase n=1 Tax=Medicago truncatula RepID=G7IHV7_MEDTR | SoyBase | E_val: 2.00E-17 | ISS |
|
Glyma20g22587 not represented in the dataset |
Glyma20g22587 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.20g093500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g22587.1 sequence type=CDS gene model=Glyma20g22587 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCAATAATAAGAATGCTAGCTTCAGCTTTGTCATGGGTGACAGTTGCTTATAGAAATTTCAGGATTCAAGCCATTCAGTTTTTCTTGGGTGACATTCAACAAACAAAAATACATCTTTTTTTTTCTCTCTCTCACACACACACCTTCCCCATTGCTAATAATTCTTACCATTCATTTTCTGGCCGCCATGCTTTCTCATCTTCTCAGCCACATGCCAATTCTAGGGTTTCAACTTCTCGGAGCTTTTGCACCACATCCTTCGACAGGGACTCCATCGAGTACGACGTCGTCATCGTCGATACCGGTCCCACCGGCTTATCGGCGACGATACAACTCAAGCAAATGTGCTGCCAAAGAAACCTCGATTTGTTCGTCTGTGTCCTCGAGAAAAGGCATGATCTGGCTACCCTCTCATGTTTTGGACGAGGCATATGA
>Glyma20g22587.1 sequence type=predicted peptide gene model=Glyma20g22587 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAIIRMLASALSWVTVAYRNFRIQAIQFFLGDIQQTKIHLFFSLSHTHTFPIANNSYHSFSGRHAFSSSQPHANSRVSTSRSFCTTSFDRDSIEYDVVIVDTGPTGLSATIQLKQMCCQRNLDLFVCVLEKRHDLATLSCFGRGI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||