Glyma20g22574 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g22574): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g22574): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g22574

Feature Type:	gene_model
Chromosome:	Gm20
Start:	32517758
stop:	32526408
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g22574

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G07100	AT	Annotation by Michelle Graham. TAIR10: Sec23/Sec24 protein transport family protein \| chr3:2245689-2250077 REVERSE LENGTH=1038	SoyBase	E_val: 2.00E-78	ISS
GO:0006486	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein glycosylation	SoyBase	N/A	ISS
GO:0006487	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation	SoyBase	N/A	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0008284	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation	SoyBase	N/A	ISS
GO:0080119	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER body organization	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0030127	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: COPII vesicle coat	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR13803	Panther	SEC24-RELATED	JGI		ISS
PF04811	PFAM	Sec23/Sec24 trunk domain	JGI		ISS
UniRef100_G7KWG6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein transport protein Sec24-like protein n=1 Tax=Medicago truncatula RepID=G7KWG6_MEDTR	SoyBase	E_val: 1.00E-81	ISS
UniRef100_I1JR27	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JR27_SOYBN	SoyBase	E_val: 1.00E-85	ISS

Expression Patterns of Glyma20g22574

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g22574 not represented in the dataset	Glyma20g22574 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g22574 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g093400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g22574

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g22574

Limit To All Plant Sequences

>Glyma20g22574.1   sequence type=CDS   gene model=Glyma20g22574   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTCAATCAAGATTGGTAACCTTGAATATTGTGCACAATTAGATGCCACTGGCAGAAGAGTTGATTTGAATCAACGACCTGAGGTTACAAAGGGTACTGTAGAATATGTTGCCCCAACAGATTATATGGTGCGGCCTCCTATGCTTCCAGTATATTTCTTCCTCATTGATGTTTCCATAACTGCAGTTAGAAGTGTAATGGTTGAGGTTGTGGCCCAAACAATCAACTCATGCTTAGATGAGCTGCCTGGCATTCCACGAACACAAATTGGGTTTGCAACTTTTGACAGCACAATACATTTTTATAACATGAAGATGTTGGTGGTCTCAGATCTGGATGACATATTTGTTCCCCTGCCAGATTATCTCCTTGTGAACTTATCAGAATCAAGAAGTGTGGTGGAAACCTTTCTTGATAGTCTGCCATCCATGTTCCAGGACAAAGTGAATCTGGAATCTGCTTTCGGTCCTGCTCTCAAGGCTGCCTTTATGATTATGGTTACTCTTAAAGATAATGATAATGAAATGTCAAGGAGGCTGAAGAAGGTACTTGAGAAATTCAGAAGTACTGACTGTGCATATTACCAATTGTGCCACCTTGTGAGGCAAGGCGAACACCCCAAAGAAGGATTCTTTCTTCTTTCAAACTTGTTTGAGGACCAGATGGGTGCTAATATTGGGTATGCTGATTGGATGCTACAGATTTCCCGACAAGTGCAGCAAGCATAA

Predicted protein sequences of Glyma20g22574

Limit To All Plant Sequences

>Glyma20g22574.1   sequence type=predicted peptide   gene model=Glyma20g22574   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSIKIGNLEYCAQLDATGRRVDLNQRPEVTKGTVEYVAPTDYMVRPPMLPVYFFLIDVSITAVRSVMVEVVAQTINSCLDELPGIPRTQIGFATFDSTIHFYNMKMLVVSDLDDIFVPLPDYLLVNLSESRSVVETFLDSLPSMFQDKVNLESAFGPALKAAFMIMVTLKDNDNEMSRRLKKVLEKFRSTDCAYYQLCHLVRQGEHPKEGFFLLSNLFEDQMGANIGYADWMLQISRQVQQA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain