Glyma20g22331 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g22331): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g22331): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g22331

Feature Type:	gene_model
Chromosome:	Gm20
Start:	32333791
stop:	32340184
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g22331

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G05870	AT	Annotation by Michelle Graham. TAIR10: anaphase-promoting complex/cyclosome 11 \| chr3:1753961-1754802 FORWARD LENGTH=87	SoyBase	E_val: 7.00E-55	ISS
GO:0007346	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of mitotic cell cycle	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
KOG1493	KOG	Anaphase-promoting complex (APC), subunit 11	JGI		ISS
PTHR11210	Panther	RING FINGER	JGI		ISS
PTHR11210:SF18	Panther	OS03G0302700 PROTEIN	JGI		ISS
UniRef100_B9RFR6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Ring finger, putative n=1 Tax=Ricinus communis RepID=B9RFR6_RICCO	SoyBase	E_val: 1.00E-53	ISS
UniRef100_B9RFR6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ring finger, putative n=1 Tax=Ricinus communis RepID=B9RFR6_RICCO	SoyBase	E_val: 1.00E-53	ISS

Expression Patterns of Glyma20g22331

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g22331 not represented in the dataset	Glyma20g22331 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g22331

Paralog	Evidence	Comments
Glyma10g28310	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g22331 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g22331

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g22331

Limit To All Plant Sequences

>Glyma20g22331.1   sequence type=CDS   gene model=Glyma20g22331   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTAACCAATTGAAGAATGCAGCCATAACCTCTACAACTTCCACAAATTTAGGGCTATACTCGACTTGCAAAAGCTTGCGAATACACAGATGGCATGCTGTTGCTTCATGGACTTGGGATGCCCAGGATGAAACCTGTGGGATTTGTAGGATGGCCTTTGATGGATGTTGTCCTGACTGCAAACTTCCTGGAGATGACTGCCCACTGATTTGGGGTGTATGCAATCACGCATTTCATCTGCACTGTATCCTGAAATGGGTGAATTCTCAGACATCACAAGCGCATTGCCCCATGTGCCGTAGGGAGTGGCAGTTTAAAGGATGA

Predicted protein sequences of Glyma20g22331

Limit To All Plant Sequences

>Glyma20g22331.1   sequence type=predicted peptide   gene model=Glyma20g22331   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLNQLKNAAITSTTSTNLGLYSTCKSLRIHRWHAVASWTWDAQDETCGICRMAFDGCCPDCKLPGDDCPLIWGVCNHAFHLHCILKWVNSQTSQAHCPMCRREWQFKG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain