SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g22255): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g22255): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g22255

Feature Type:gene_model
Chromosome:Gm20
Start:32281849
stop:32283676
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11910AT Annotation by Michelle Graham. TAIR10: aspartic proteinase A1 | chr1:4017119-4019874 REVERSE LENGTH=506 SoyBaseE_val: 2.00E-41ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006629GO-bp Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048513GO-bp Annotation by Michelle Graham. GO Biological Process: organ development SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0004175GO-mf Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity SoyBaseN/AISS
GO:0004190GO-mf Annotation by Michelle Graham. GO Molecular Function: aspartic-type endopeptidase activity SoyBaseN/AISS
PTHR13683Panther ASPARTYL PROTEASES JGI ISS
PTHR13683:SF85Panther gb def: cg10104-pa [drosophila melanogaster] JGI ISS
PF00026PFAM Eukaryotic aspartyl protease JGI ISS
PF05184PFAM Saposin-like type B, region 1 JGI ISS
UniRef100_I1NEU4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NEU4_SOYBN SoyBaseE_val: 4.00E-88ISS
UniRef100_Q948P0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aspartic proteinase 2 n=1 Tax=Glycine max RepID=Q948P0_SOYBN SoyBaseE_val: 3.00E-67ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g22255 not represented in the dataset

Glyma20g22255 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g090900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g22255.1   sequence type=CDS   gene model=Glyma20g22255   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTACGACCTGATGATGTATGCTCACAGGTTGGCTTATGTTTCAAAAGGACTAAATCAGAGAGCAATGGAATTGAGATGGTGACCGAAAAGGAACAGAGAGAGTTGTCAACTGAAGATACTGCTTTGTGCACTTCCTGTCAGATGCTCGTGGTTTGGATTCAGAATCAACTAAAACAAAAGAAGACCAAGGAGATAGTATTCAACTATGTAAATCAGCTGTGCGAGAGCTTGCCGAGTCCAAATGGAGAGTCAGTAGTAGACTGTAATAGCATTTATGGATTGCCAAACATCACGTTTACTGTTGGAGACAAACCTTTCACCCACACTCCTGAGCAGTATATTCTGAAAACTGGAGAAGGCATTGCAGAAGTTTGCCTTAGTGGGTTTATTGCTTTTGACATTCCTTTCATTTTTCTCATAGTACAGAACAGCGCATGA

>Glyma20g22255.1   sequence type=predicted peptide   gene model=Glyma20g22255   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVRPDDVCSQVGLCFKRTKSESNGIEMVTEKEQRELSTEDTALCTSCQMLVVWIQNQLKQKKTKEIVFNYVNQLCESLPSPNGESVVDCNSIYGLPNITFTVGDKPFTHTPEQYILKTGEGIAEVCLSGFIAFDIPFIFLIVQNSA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo