Glyma20g22255 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g22255): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g22255): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g22255

Feature Type:	gene_model
Chromosome:	Gm20
Start:	32281849
stop:	32283676
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g22255

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G11910	AT	Annotation by Michelle Graham. TAIR10: aspartic proteinase A1 \| chr1:4017119-4019874 REVERSE LENGTH=506	SoyBase	E_val: 2.00E-41	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0006629	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid metabolic process	SoyBase	N/A	ISS
GO:0006833	GO-bp	Annotation by Michelle Graham. GO Biological Process: water transport	SoyBase	N/A	ISS
GO:0006972	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic response	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0009266	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0048513	GO-bp	Annotation by Michelle Graham. GO Biological Process: organ development	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0004175	GO-mf	Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity	SoyBase	N/A	ISS
GO:0004190	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aspartic-type endopeptidase activity	SoyBase	N/A	ISS
PTHR13683	Panther	ASPARTYL PROTEASES	JGI		ISS
PTHR13683:SF85	Panther	gb def: cg10104-pa [drosophila melanogaster]	JGI		ISS
PF00026	PFAM	Eukaryotic aspartyl protease	JGI		ISS
PF05184	PFAM	Saposin-like type B, region 1	JGI		ISS
UniRef100_I1NEU4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NEU4_SOYBN	SoyBase	E_val: 4.00E-88	ISS
UniRef100_Q948P0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aspartic proteinase 2 n=1 Tax=Glycine max RepID=Q948P0_SOYBN	SoyBase	E_val: 3.00E-67	ISS

Expression Patterns of Glyma20g22255

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g22255 not represented in the dataset	Glyma20g22255 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g22255 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g090900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g22255

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g22255

Limit To All Plant Sequences

>Glyma20g22255.1   sequence type=CDS   gene model=Glyma20g22255   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTACGACCTGATGATGTATGCTCACAGGTTGGCTTATGTTTCAAAAGGACTAAATCAGAGAGCAATGGAATTGAGATGGTGACCGAAAAGGAACAGAGAGAGTTGTCAACTGAAGATACTGCTTTGTGCACTTCCTGTCAGATGCTCGTGGTTTGGATTCAGAATCAACTAAAACAAAAGAAGACCAAGGAGATAGTATTCAACTATGTAAATCAGCTGTGCGAGAGCTTGCCGAGTCCAAATGGAGAGTCAGTAGTAGACTGTAATAGCATTTATGGATTGCCAAACATCACGTTTACTGTTGGAGACAAACCTTTCACCCACACTCCTGAGCAGTATATTCTGAAAACTGGAGAAGGCATTGCAGAAGTTTGCCTTAGTGGGTTTATTGCTTTTGACATTCCTTTCATTTTTCTCATAGTACAGAACAGCGCATGA

Predicted protein sequences of Glyma20g22255

Limit To All Plant Sequences

>Glyma20g22255.1   sequence type=predicted peptide   gene model=Glyma20g22255   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVRPDDVCSQVGLCFKRTKSESNGIEMVTEKEQRELSTEDTALCTSCQMLVVWIQNQLKQKKTKEIVFNYVNQLCESLPSPNGESVVDCNSIYGLPNITFTVGDKPFTHTPEQYILKTGEGIAEVCLSGFIAFDIPFIFLIVQNSA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain