Report for Sequence Feature Glyma20g21983
Feature Type: gene_model
Chromosome: Gm20
Start: 31807410
stop: 31808954
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma20g21983
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G43440 AT
Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr5:17455356-17456608 REVERSE LENGTH=365
SoyBase E_val: 8.00E-56 ISS
GO:0055114 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0009815 GO-mf
Annotation by Michelle Graham. GO Molecular Function: 1-aminocyclopropane-1-carboxylate oxidase activity
SoyBase N/A ISS
GO:0016491 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity
SoyBase N/A ISS
GO:0016706 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
SoyBase N/A ISS
PTHR10209 Panther
FE(II)/ ASCORBATE OXIDASE SUPERFAMILY
JGI ISS
PTHR10209:SF55 Panther
OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI
JGI ISS
PF03171 PFAM
2OG-Fe(II) oxygenase superfamily
JGI ISS
UniRef100_C6TKT7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TKT7_SOYBN
SoyBase E_val: 3.00E-83 ISS
UniRef100_G7I5H7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 1-aminocyclopropane-1-carboxylate oxidase-like protein n=1 Tax=Medicago truncatula RepID=G7I5H7_MEDTR
SoyBase E_val: 1.00E-64 ISS
Expression Patterns of Glyma20g21983
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma20g21983
Paralog Evidence Comments
Glyma10g01050 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma20g21983 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.20g088400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma20g21983
Coding sequences of Glyma20g21983
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma20g21983.1 sequence type=CDS gene model=Glyma20g21983 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGGATTACTCAAATCAAGTAATGAAACTAGGGACTTTATTGTTTGAGTTATTATCAGAAGCTCTTAGTTTGAATTCAACCTACTTAAGAGATACAAGTTGCGATGTGGGACAATTTGCTTTTGGTCATTACTATCCTTCCTATCTTGAACCAAACTTAACTCTGGGAACCATAAAGCATGTTGATGTTAATTTCATCACAGTGCTTCTACAAGGCCATATAGGTGGCCTCCAAGTTCTTCATCAGAACACACAAATCGATGTAACCCCTGTGCCTGGGGCTCTATTTATTATATGTGATCCTTCACCAATATGGCTAATTCCTAATATTCTTGAATGCCAACTTATCTCAAATGACAAATTCAAGAGTGGTCAACATAGAGTACCGGCAAATACTGCAGGTCCAAGAGTCTCCATTTCCAGCATTCATCCATCTTCAAGGACTTATGGTCCCATCATGGAACTTTTATCTGAAGACAATCCTGCAAAATATAGAGAATTTTCAATTCCAGAATTTACAGCTCACTACTGA
Predicted protein sequences of Glyma20g21983
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma20g21983.1 sequence type=predicted peptide gene model=Glyma20g21983 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVDYSNQVMKLGTLLFELLSEALSLNSTYLRDTSCDVGQFAFGHYYPSYLEPNLTLGTIKHVDVNFITVLLQGHIGGLQVLHQNTQIDVTPVPGALFIICDPSPIWLIPNILECQLISNDKFKSGQHRVPANTAGPRVSISSIHPSSRTYGPIMELLSEDNPAKYREFSIPEFTAHY*