SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g21693

Feature Type:gene_model
Chromosome:Gm20
Start:31187632
stop:31192534
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g21693
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G46850AT Annotation by Michelle Graham. TAIR10: Subtilase family protein | chr3:17256338-17259442 FORWARD LENGTH=736 SoyBaseE_val: 1.00E-15ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0043086GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of catalytic activity SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0004252GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
PF02225PFAM PA domain JGI ISS
UniRef100_B9SE32UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cucumisin, putative n=1 Tax=Ricinus communis RepID=B9SE32_RICCO SoyBaseE_val: 5.00E-24ISS
UniRef100_UPI0002337A37UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337A37 related cluster n=1 Tax=unknown RepID=UPI0002337A37 SoyBaseE_val: 8.00E-66ISS

Expression Patterns of Glyma20g21693
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g21693 not represented in the dataset
Glyma20g21693 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g21693 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g086800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g21693
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g21693
>Glyma20g21693.1   sequence type=CDS   gene model=Glyma20g21693   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACCATGGTTACTTTCTGTGGCTGCTAGGATGCACTTTTGACAGAAAGATTGTCACCAAGGTGCAATTGGGCAATGGGGCTATTTATGGGGGAGTTTCAATTAACACATTTGATCTTAAGAAAAAATTCTATCCACTGGTTTACGGTGGACATAACAGCTCCACATCCAGGTATTCCCTAGAGGACTCTTTGGATAAACATTCAGTGAAGGGAAAGATTGTTCTGTGTGACCTAATTCAGGCTTCTGACGACGTGGGGATTTTATCTGGGCCAGCTGGTGTTATATTTGGACTTAATTACCCTCAAGATTTGCGCGGAACATATGCCCTACCTGCTTTGCAGATTGCTCAGAGGGACCAAAGACTAATACATTCTTACATAACTTCAACCAGATACCTCATTGTCTGA
Predicted protein sequences of Glyma20g21693
>Glyma20g21693.1   sequence type=predicted peptide   gene model=Glyma20g21693   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHHGYFLWLLGCTFDRKIVTKVQLGNGAIYGGVSINTFDLKKKFYPLVYGGHNSSTSRYSLEDSLDKHSVKGKIVLCDLIQASDDVGILSGPAGVIFGLNYPQDLRGTYALPALQIAQRDQRLIHSYITSTRYLIV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo