|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G46850 | AT | Annotation by Michelle Graham. TAIR10: Subtilase family protein | chr3:17256338-17259442 FORWARD LENGTH=736 | SoyBase | E_val: 1.00E-15 | ISS |
GO:0006508 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteolysis | SoyBase | N/A | ISS |
GO:0008152 | GO-bp | Annotation by Michelle Graham. GO Biological Process: metabolic process | SoyBase | N/A | ISS |
GO:0043086 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of catalytic activity | SoyBase | N/A | ISS |
GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
GO:0004252 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity | SoyBase | N/A | ISS |
GO:0042802 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: identical protein binding | SoyBase | N/A | ISS |
PF02225 | PFAM | PA domain | JGI | ISS | |
UniRef100_B9SE32 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cucumisin, putative n=1 Tax=Ricinus communis RepID=B9SE32_RICCO | SoyBase | E_val: 5.00E-24 | ISS |
UniRef100_UPI0002337A37 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002337A37 related cluster n=1 Tax=unknown RepID=UPI0002337A37 | SoyBase | E_val: 8.00E-66 | ISS |
Glyma20g21693 not represented in the dataset |
Glyma20g21693 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.20g086800 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g21693.1 sequence type=CDS gene model=Glyma20g21693 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCACCATGGTTACTTTCTGTGGCTGCTAGGATGCACTTTTGACAGAAAGATTGTCACCAAGGTGCAATTGGGCAATGGGGCTATTTATGGGGGAGTTTCAATTAACACATTTGATCTTAAGAAAAAATTCTATCCACTGGTTTACGGTGGACATAACAGCTCCACATCCAGGTATTCCCTAGAGGACTCTTTGGATAAACATTCAGTGAAGGGAAAGATTGTTCTGTGTGACCTAATTCAGGCTTCTGACGACGTGGGGATTTTATCTGGGCCAGCTGGTGTTATATTTGGACTTAATTACCCTCAAGATTTGCGCGGAACATATGCCCTACCTGCTTTGCAGATTGCTCAGAGGGACCAAAGACTAATACATTCTTACATAACTTCAACCAGATACCTCATTGTCTGA
>Glyma20g21693.1 sequence type=predicted peptide gene model=Glyma20g21693 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MHHGYFLWLLGCTFDRKIVTKVQLGNGAIYGGVSINTFDLKKKFYPLVYGGHNSSTSRYSLEDSLDKHSVKGKIVLCDLIQASDDVGILSGPAGVIFGLNYPQDLRGTYALPALQIAQRDQRLIHSYITSTRYLIV*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||