Report for Sequence Feature Glyma20g21520
Feature Type: gene_model
Chromosome: Gm20
Start: 30860603
stop: 30862245
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma20g21520
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G05620 AT
Annotation by Michelle Graham. TAIR10: proton gradient regulation 5 | chr2:2081204-2081687 REVERSE LENGTH=133
SoyBase E_val: 3.00E-65 ISS
GO:0009414 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to water deprivation
SoyBase N/A ISS
GO:0009637 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to blue light
SoyBase N/A ISS
GO:0009644 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to high light intensity
SoyBase N/A ISS
GO:0009744 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus
SoyBase N/A ISS
GO:0009773 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I
SoyBase N/A ISS
GO:0010114 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to red light
SoyBase N/A ISS
GO:0010117 GO-bp
Annotation by Michelle Graham. GO Biological Process: photoprotection
SoyBase N/A ISS
GO:0010155 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of proton transport
SoyBase N/A ISS
GO:0010218 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to far red light
SoyBase N/A ISS
GO:0071484 GO-bp
Annotation by Michelle Graham. GO Biological Process: cellular response to light intensity
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009534 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid
SoyBase N/A ISS
GO:0009535 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane
SoyBase N/A ISS
GO:0009055 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron carrier activity
SoyBase N/A ISS
UniRef100_C6TMI4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TMI4_SOYBN
SoyBase E_val: 9.00E-87 ISS
UniRef100_G7I6M5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Protein PROTON GRADIENT REGULATION n=1 Tax=Medicago truncatula RepID=G7I6M5_MEDTR
SoyBase E_val: 1.00E-79 ISS
Expression Patterns of Glyma20g21520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma20g21520
Paralog Evidence Comments
Glyma10g27610 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma20g21520 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.20g085900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma20g21520
Coding sequences of Glyma20g21520
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma20g21520.1 sequence type=CDS gene model=Glyma20g21520 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTACTTCACTTTCAGCAACTGGGTGTGTTGGAACTTCCTTCTATGGAAGTTGGGGCACTTCAATTGTTGGGGAGGATTACACCATGCTGGCCAAGTCAGTGCCATCACAAGTTCGTATGGGGAGGGGAAAGCCAGTGAGATTGCAGCCTATGATGAAGAATGTCAATGAAGGGAAAGGTATCTTTGCACCTCTTGTGGTGATCACTCGCAACATCGTTGGCAAGAAGCGTTTCAACCAGCTTAGAGGCAAAGCAATTGCTTTACACTCCCAGGTGATCACGGAGTTCTGCAAATCAATAGGAGCAGATGGAAAACAGAGACAAGGGCTGATCAGGTTGGCCAAGAAGAATGGAGAATGGCTTGGTTTTCTTGCATGA
Predicted protein sequences of Glyma20g21520
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma20g21520.1 sequence type=predicted peptide gene model=Glyma20g21520 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MATSLSATGCVGTSFYGSWGTSIVGEDYTMLAKSVPSQVRMGRGKPVRLQPMMKNVNEGKGIFAPLVVITRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADGKQRQGLIRLAKKNGEWLGFLA*