SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g21431): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g21431): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g21431

Feature Type:gene_model
Chromosome:Gm20
Start:30690661
stop:30695145
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G04400AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L14p/L23e family protein | chr3:1167339-1168308 FORWARD LENGTH=140 SoyBaseE_val: 1.00E-69ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG0901 KOG 60S ribosomal protein L14/L17/L23 JGI ISS
PTHR11761Panther 50S RIBOSOMAL PROTEIN L14-RELATED JGI ISS
PF00238PFAM Ribosomal protein L14p/L23e JGI ISS
UniRef100_B3TLN0UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L17 n=13 Tax=Magnoliophyta RepID=B3TLN0_ELAGV SoyBaseE_val: 9.00E-68ISS
UniRef100_UPI000233DA02UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DA02 related cluster n=1 Tax=unknown RepID=UPI000233DA02 SoyBaseE_val: 4.00E-74ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g21431 not represented in the dataset

Glyma20g21431 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g085400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g21431.1   sequence type=CDS   gene model=Glyma20g21431   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGAAGCGAGGACGTGGTGGTTCTGCTGGTAACAAGTTCAGGATGTCACTGGGTTTGCCAGTGGCAGCTGTGAATCTTTACATCATATCGGTGAAAGGAATCAAGGGTCGCCTCAACAGATTGCCATATGCTTGTGTTGGTGACTTGGTCATGGCTACTGTGAAAAAGGGGAAGCCCAATCTTAGGAAGAAGGTATTGCCAGCAGTTATTGTGAGACAGCGTAACCCGTGGAGAAGAAAGGATGGTGCCTACATGTACTTTGAAGATAATGCAAGTGTTATCGTAAACTCAGGGAGAAATGAAAGGTATGAAATACATTTCTCAAATTGTGTTGATATTTTGCATTTGACATGTTCTGCCTTAACTGGGCCTATTAGCAAGGAGTGTGCTGATCTGTGGCCCAGAATTGCAAGTGCTGCCAATGCCATTGTCTGA

>Glyma20g21431.1   sequence type=predicted peptide   gene model=Glyma20g21431   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKRGRGGSAGNKFRMSLGLPVAAVNLYIISVKGIKGRLNRLPYACVGDLVMATVKKGKPNLRKKVLPAVIVRQRNPWRRKDGAYMYFEDNASVIVNSGRNERYEIHFSNCVDILHLTCSALTGPISKECADLWPRIASAANAIV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo