SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma20g21250

Feature Type:gene_model
Chromosome:Gm20
Start:30398783
stop:30401417
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G30220AT Annotation by Michelle Graham. TAIR10: small nuclear ribonucleoprotein F | chr4:14803100-14804259 REVERSE LENGTH=88 SoyBaseE_val: 1.00E-52ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005732GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3482 KOG Small nuclear ribonucleoprotein (snRNP) SMF JGI ISS
PTHR11021Panther SMALL NUCLEAR RIBONUCLEOPROTEIN F (SNRNP-F) JGI ISS
PF01423PFAM LSM domain JGI ISS
UniRef100_C6SYQ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYQ7_SOYBN SoyBaseE_val: 1.00E-56ISS
UniRef100_G7JVF0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Small nuclear ribonucleoprotein F n=1 Tax=Medicago truncatula RepID=G7JVF0_MEDTR SoyBaseE_val: 2.00E-54ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g07060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g084000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g21250.1   sequence type=CDS   gene model=Glyma20g21250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACTATTCCAGTTAACCCCAAGCCTTTCTTGAACAATTTGACTGGGAAGCCCGTAATTGTGAAACTCAAGTGGGGAATGGAGTACAAGGGCTATCTCGTTTCCGTTGATTCCTACATGAACTTGCAGCTGGCCAACACTGAAGAGTACATTGAGGGACAGTTTACTGGAAATTTGGGAGAGATTTTAATCAGATGTAACAATGTTCTCTACCTTCGAGGAGTACCGGAGGATGAGGAAATCGAAGATGTTGCAGAAGACTAG

>Glyma20g21250.1   sequence type=predicted peptide   gene model=Glyma20g21250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATIPVNPKPFLNNLTGKPVIVKLKWGMEYKGYLVSVDSYMNLQLANTEEYIEGQFTGNLGEILIRCNNVLYLRGVPEDEEIEDVAED*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo