Glyma20g21230 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g21230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g21230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g21230

Feature Type:	gene_model
Chromosome:	Gm20
Start:	30345125
stop:	30346200
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g21230

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G59970	AT	Annotation by Michelle Graham. TAIR10: Histone superfamily protein \| chr5:24146352-24146663 REVERSE LENGTH=103	SoyBase	E_val: 7.00E-67	ISS
GO:0006334	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleosome assembly	SoyBase	N/A	ISS
GO:0000786	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleosome	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
KOG3467	KOG	Histone H4	JGI		ISS
PTHR10484	Panther	HISTONE H4	JGI		ISS
PF00125	PFAM	Core histone H2A/H2B/H3/H4	JGI		ISS
UniRef100_B6T0P4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histone H4 n=1 Tax=Zea mays RepID=B6T0P4_MAIZE	SoyBase	E_val: 2.00E-65	ISS
UniRef100_B6T0P4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Histone H4 n=1 Tax=Zea mays RepID=B6T0P4_MAIZE	SoyBase	E_val: 2.00E-65	ISS

Expression Patterns of Glyma20g21230

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g21230 not represented in the dataset	Glyma20g21230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g21230

Paralog	Evidence	Comments
Glyma10g26820	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma17g07070	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g21230 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g083800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g21230

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g21230

Limit To All Plant Sequences

>Glyma20g21230.1   sequence type=CDS   gene model=Glyma20g21230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGAAGAGGAAAGGGAGGCAAGGGTCTCGGAAAGGGAGGAGCGAAACGACACCGTAAGGTTCTGAGGGATAACATTCAGGGCATAACGAAGCCCGCAATTCGCCGTCTCGCGAGACGTGGCGGCGTGAAGCGTATCAGTGGTCTCATCTACGAAGAAACCCGCGGTGTTCTCAAGATCTTCCTCGAGAACGTCATTCGCGACGCTGTCACCTACACTGAGCACGCTCGCCGCAAGACCGTCACTGCCATGGACGTTGTTTACGCCCTCAAGAGGCAGGGCAGGACCCTCTACGGTTTCGGCGGTTAG

Predicted protein sequences of Glyma20g21230

Limit To All Plant Sequences

>Glyma20g21230.1   sequence type=predicted peptide   gene model=Glyma20g21230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain