Report for Sequence Feature Glyma20g21190
Feature Type: gene_model
Chromosome: Gm20
Start: 30239570
stop: 30241733
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma20g21190
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G35530 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein S3 family protein | chr5:13710355-13712192 REVERSE LENGTH=248
SoyBase E_val: 6.00E-150 ISS
GO:0001510 GO-bp
Annotation by Michelle Graham. GO Biological Process: RNA methylation
SoyBase N/A ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0009651 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salt stress
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005730 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleolus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0015935 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0022626 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome
SoyBase N/A ISS
GO:0022627 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit
SoyBase N/A ISS
GO:0003723 GO-mf
Annotation by Michelle Graham. GO Molecular Function: RNA binding
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
KOG3181
KOG
40S ribosomal protein S3
JGI ISS
PTHR11760 Panther
30S RIBOSOMAL PROTEIN S3
JGI ISS
PF00189 PFAM
Ribosomal protein S3, C-terminal domain
JGI ISS
PF07650 PFAM
KH domain
JGI ISS
UniRef100_G8A1S3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S3 n=1 Tax=Medicago truncatula RepID=G8A1S3_MEDTR
SoyBase E_val: 3.00E-164 ISS
UniRef100_UPI00018C69B3 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI00018C69B3 related cluster n=1 Tax=unknown RepID=UPI00018C69B3
SoyBase E_val: 3.00E-171 ISS
Expression Patterns of Glyma20g21190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma20g21190
Paralog Evidence Comments
Glyma10g26790 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma20g21190 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.20g083300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma20g21190
Coding sequences of Glyma20g21190
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma20g21190.1 sequence type=CDS gene model=Glyma20g21190 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCACCCAAATGAGCAAGAAGAGAAAGTTCGTAGCTGATGGAGTGTTCTTCGCTGAACTGAACGAGGTTCTGACAAGGGAGTTAGCCGAGGACGGATACTCCGGCGTGGAAGTTAGGGTTACGCCGATGCGCACCGAAATCATCATCAGAGCCACCAGAACCCAAGCCGTTCTCGGTGAGAAGGGAAGGAGAATCAGGGAACTTACCTCGGTGGTTCAGAAGAGGTTCAAGTTTCCCGAGAACAGTGTTGAACTTTATGCTGAAAAGGTCAACAATAGGGGTCTTTGCGCTATAGCACAGGCTGAGTCTCTCCGCTACAAGCTCCTTGGTGGCCTAGCTGTGCGCAGGGCTTGCTATGGTGTCTTGAGGTTTGTTATGGAGAGTGGTGCTAAGGGATGCGAGGTCATTGTGAGTGGAAAATTGAGAGCCCAGAGAGCCAAATCTATGAAGTTTAAGGATGGTTACATGATTTCTTCTGGGCAACCTGTCAAAGATTACATTGACTCTGCAGTGAGACATGTGCTCCTGAGACAGGGTGTTCTTGGCATTAAGGTGAAGATCATGCTTGATTGGGATCCTAAGGGGAAACAGGGTCCTAAAACTCCCCTCCCTGATCTTGTCACAATCCATTCTCCAAAGGAGGAAGAAGAATACATCCAGCCTGCTCCAGTTTTGGCTGCTAATGATATTGAGGTCCCTGTTGCTTGA
Predicted protein sequences of Glyma20g21190
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma20g21190.1 sequence type=predicted peptide gene model=Glyma20g21190 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MATQMSKKRKFVADGVFFAELNEVLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELTSVVQKRFKFPENSVELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHSPKEEEEYIQPAPVLAANDIEVPVA*