Glyma20g21030 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g21030

Feature Type:	gene_model
Chromosome:	Gm20
Start:	29984895
stop:	29986397
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g21030

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G13510	AT	Annotation by Michelle Graham. TAIR10: ammonium transporter 1;1 \| chr4:7858220-7859725 FORWARD LENGTH=501	SoyBase	E_val: 0	ISS
GO:0001666	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hypoxia	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006820	GO-bp	Annotation by Michelle Graham. GO Biological Process: anion transport	SoyBase	N/A	ISS
GO:0006862	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide transport	SoyBase	N/A	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0010311	GO-bp	Annotation by Michelle Graham. GO Biological Process: lateral root formation	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0015695	GO-bp	Annotation by Michelle Graham. GO Biological Process: organic cation transport	SoyBase	N/A	ISS
GO:0015696	GO-bp	Annotation by Michelle Graham. GO Biological Process: ammonium transport	SoyBase	N/A	ISS
GO:0015802	GO-bp	Annotation by Michelle Graham. GO Biological Process: basic amino acid transport	SoyBase	N/A	ISS
GO:0031347	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of defense response	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0043090	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid import	SoyBase	N/A	ISS
GO:0043269	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of ion transport	SoyBase	N/A	ISS
GO:0051258	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein polymerization	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0080181	GO-bp	Annotation by Michelle Graham. GO Biological Process: lateral root branching	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008519	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ammonium transmembrane transporter activity	SoyBase	N/A	ISS
KOG0682	KOG	Ammonia permease	JGI		ISS
PTHR11730	Panther	AMMONIUM TRANSPORTER	JGI		ISS
PTHR11730:SF8	Panther	AMMONIUM TRANSPORTER 1	JGI		ISS
PF00909	PFAM	Ammonium Transporter Family	JGI		ISS
UniRef100_I1NEM1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NEM1_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q9FSH3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ammonium transporter (AMT1.1) n=1 Tax=Lotus japonicus RepID=Q9FSH3_LOTJA	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma20g21030

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g21030

Paralog	Evidence	Comments
Glyma10g26690	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g21030 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g21030

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g21030

Limit To All Plant Sequences

>Glyma20g21030.1   sequence type=CDS   gene model=Glyma20g21030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGCTGCCAGATTGTCCCGCCGTCCAACTTGCCCAACTCCTGGGCCCAAATACCACAAACGCTGCCGCCGCCGCCTCCTTCATCTGCGACCGGTTCACCGCCGTGGACAACAAGTTCGTCGACACGGCCTTCGCGGTCGACAACACTTACCTCCTCTTCTCCGCCTACCTCGTCTTCTCGATGCAGCTCGGCTTCGCCATGCTCTGCGCCGGCTCCGTCCGCGCCAAGAACACCATGAACATCATGCTCACCAACGTCCTCGACGCCGCCGCCGGCGGCCTCTTCTACTACCTCTTCGGCTTCGCCTTCGCCTTCGGCTCCCCCTCCAACGGCTTCATTGGCAAACACTTCTTCGGCCTCAAGGAACTCCCCTCCCAAAGCTTCGACTACAGCAACTTTCTCTATCAATGGGCCTTCGCCATCGCCGCCGCCGGCATCACCAGCGGCTCCATCGCCGAACGCACACAGTTCGTGGCCTATCTCATCTACTCCTCCTTCCTCACCGGCTTCGTCTACCCCGTCGTCTCCCACTGGTTCTGGTCCGCAGACGGCTGGGCTTCTGCCATTTCCCCCGGAGACCGGCTATTTTCCACCGGCGTGATAGACTTCGCCGGCTCCGGCGTAGTCCACATGGTTGGTGGAGTAGCCGGCTTCTGGGGCGCACTGATAGAAGGCCCGAGAATCGGACGCTTCGACCACGCGGGACGCGCCGTTGCCCTCAGAGGCCACAGCGCGTCCTTAGTAGTCCTGGGGACCTTCATGCTTTGGTTCGGTTGGTACGGATTTAACCCTGGTTCATTTAATAAAATCCTAGTTTCCTACGGTAACTCAGGAACTTACTACGGTCAATGGAGCGCGGTTGGGAGAACCGCGGTCACCACTACCCTTGCAGGGTCAACTGCTGCGTTGACCACTCTCTTCGGGAAACGGATGATATCCGGTCATTGGAACGTGACCGATGTCTGCAACGGGCTGTTAGGCGGCTTCGCCGCCATAACAGCCGGCTGCTCCGTCGTTGAGCCATGGGCAGCCATCGTGTGTGGTTTTGTCGCTTCAGTGGTTCTGATAGCGTGCAACAAATTAGCAGAGAAGGTTAAGTTCGATGATCCTTTGGAAGCGGCGCAGTTACACGGTGGGTGTGGCGCGTGGGGGGTGATATTCACGGCGCTGTTCGCGAAAAAGGAGTATGTGAGCCAGGTTTATGGGGAGGGGAGGGCGCACGGGTTGTTCATGAGGGGTGGAGGGAAGTTGCTGGCGGCGCACGTGATTCAGATTTTGGTTATTGTTGGGTGGGTGAGTGCGACCATGGGACCCTTGTTTTGGGGGTTGAATAAATTGAAATTGTTGAGGATTTCTTCCGAGGATGAGCTTGCGGGGATGGATCTTACCCGTCATGGAGGATTTGCTTATGCTTATGAGGATGATGAGTCGCACAAGCATGGGATTCAGCTGAGGAAGGTTGGGCCCAACGCGTCGTCCACACCCACCACTGATGAATGA

Predicted protein sequences of Glyma20g21030

Limit To All Plant Sequences

>Glyma20g21030.1   sequence type=predicted peptide   gene model=Glyma20g21030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLPDCPAVQLAQLLGPNTTNAAAAASFICDRFTAVDNKFVDTAFAVDNTYLLFSAYLVFSMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGGLFYYLFGFAFAFGSPSNGFIGKHFFGLKELPSQSFDYSNFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPVVSHWFWSADGWASAISPGDRLFSTGVIDFAGSGVVHMVGGVAGFWGALIEGPRIGRFDHAGRAVALRGHSASLVVLGTFMLWFGWYGFNPGSFNKILVSYGNSGTYYGQWSAVGRTAVTTTLAGSTAALTTLFGKRMISGHWNVTDVCNGLLGGFAAITAGCSVVEPWAAIVCGFVASVVLIACNKLAEKVKFDDPLEAAQLHGGCGAWGVIFTALFAKKEYVSQVYGEGRAHGLFMRGGGKLLAAHVIQILVIVGWVSATMGPLFWGLNKLKLLRISSEDELAGMDLTRHGGFAYAYEDDESHKHGIQLRKVGPNASSTPTTDE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain