Glyma20g19590 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g19590

Feature Type:	gene_model
Chromosome:	Gm20
Start:	27604857
stop:	27606056
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g19590

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G43960	AT	Annotation by Michelle Graham. TAIR10: Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain \| chr5:17689154-17691220 REVERSE LENGTH=391	SoyBase	E_val: 1.00E-23	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006913	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
PTHR10693	Panther	RNA-BINDING RAS-GAP SH3 BINDING PROTEIN RELATED	JGI		ISS
PTHR10693:SF8	Panther	NUCLEAR TRANSPORT FACTOR 2 (NTF2) FAMILY PROTEIN /	JGI		ISS
PF00076	PFAM	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	JGI		ISS
UniRef100_B9SQT0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ras-GTPase-activating protein-binding protein, putative n=1 Tax=Ricinus communis RepID=B9SQT0_RICCO	SoyBase	E_val: 9.00E-30	ISS
UniRef100_UPI000233D9F6	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D9F6 related cluster n=1 Tax=unknown RepID=UPI000233D9F6	SoyBase	E_val: 3.00E-40	ISS

Expression Patterns of Glyma20g19590

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g19590 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g19590

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g19590

Limit To All Plant Sequences

>Glyma20g19590.1   sequence type=CDS   gene model=Glyma20g19590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGAAATCTTGATTCAAAATTGAATGCTTCAAGTGCAACCAATAAACCTGGTAAGTTCTTGCACCAGTTGTGTTCTTGTACCATACATTCTTTCTTGCATCATGTATTGTCACTACCACTAATCTTGATTTTTTTGGGATTGCTTTCAGATAAAATCAAGTCTGTTTATGTGAGAAACTTGTCACCTGCAGTGTCTCCTAAAATTGAAGACGAATTCAAGAATTTTGGTAGAATCCGGCTTGATGGTGTTGTTATTAGAAGTCACAAGGATGTCGGTGTTTGTTATGCATTTGTTGAATTTGAAGATATGACTGGCGTTCATAATGCATTTGGGATATGCACTACACTCTTGAATTGTGATGTAGTAATGCACCTTGACCCAAAGCTAATACTGAACTTGCTATCAGGATCTGTTCAAATAGCAGGAAGACAAGTATACATTGAAGAACGAAGACCAAACAGTAACATCCCTTCTCGAGGAGGAAAGGATGGTTCATATCCTCAACTGCTACATCTTGCTTCCCTATCCGGAATACTAAAA

Predicted protein sequences of Glyma20g19590

Limit To All Plant Sequences

>Glyma20g19590.1   sequence type=predicted peptide   gene model=Glyma20g19590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RNLDSKLNASSATNKPGKFLHQLCSCTIHSFLHHVLSLPLILIFLGLLSDKIKSVYVRNLSPAVSPKIEDEFKNFGRIRLDGVVIRSHKDVGVCYAFVEFEDMTGVHNAFGICTTLLNCDVVMHLDPKLILNLLSGSVQIAGRQVYIEERRPNSNIPSRGGKDGSYPQLLHLASLSGILK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain