SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g18881): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g18881): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g18881

Feature Type:gene_model
Chromosome:Gm20
Start:26511196
stop:26515270
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g18881
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45320AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 10 growth stages; Has 45 Blast hits to 45 proteins in 16 species: Archae - 0; Bacteria - 8; Metazoa - 0; Fungi - 0; Plants - 37; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:18684182-18686107 REVERSE LENGTH=392 SoyBaseE_val: 2.00E-30ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_UPI000233D99BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D99B related cluster n=1 Tax=unknown RepID=UPI000233D99B SoyBaseE_val: 1.00E-103ISS

Expression Patterns of Glyma20g18881
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g18881 not represented in the dataset
Glyma20g18881 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g18881 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g076400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g18881
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g18881
>Glyma20g18881.1   sequence type=CDS   gene model=Glyma20g18881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCATGATTCTAGTGAAGTTGGTAAAGCTTGCCTTTGTTACGGGAATATGGCCAATGCATGGAAGCACAAAATATAGAAATGCTTCCCGCATGCTGGGTGATCAGTTAGCTCTTGCTTCAGTTGAGATGTCAAAACCTCATTTTGACACCAGCAAGTTTGCCAAAGCTCTTGCTTTCTCTGAAGATATTGGGGGTAGTTCAATATTGTTTTTACCTTGTTCTATGTACAATTGGACTCTGCCTGAGGGTGCTGGTCAATTTCATGGTATGCCATTGGATGTTAAGATTTATGCTACCCATCAACTAGAATTCTTGGAAGTTGCAGACCTCATTTTTGAAAGCTGCAGAAAGGCAGAGTCAACACCAAATAACTTATGGGAACATTTGCTCTTTTATCTTTTGGTGGCACCATCTTCATACTGGGAAGGACTGTTTTAA
Predicted protein sequences of Glyma20g18881
>Glyma20g18881.1   sequence type=predicted peptide   gene model=Glyma20g18881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIMILVKLVKLAFVTGIWPMHGSTKYRNASRMLGDQLALASVEMSKPHFDTSKFAKALAFSEDIGGSSILFLPCSMYNWTLPEGAGQFHGMPLDVKIYATHQLEFLEVADLIFESCRKAESTPNNLWEHLLFYLLVAPSSYWEGLF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo