SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g18860

Feature Type:gene_model
Chromosome:Gm20
Start:26435423
stop:26439235
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g18860
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04760AT Annotation by Michelle Graham. TAIR10: vesicle-associated membrane protein 726 | chr1:1334760-1336070 FORWARD LENGTH=220 SoyBaseE_val: 2.00E-132ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0048451GO-bp Annotation by Michelle Graham. GO Biological Process: petal formation SoyBaseN/AISS
GO:0048453GO-bp Annotation by Michelle Graham. GO Biological Process: sepal formation SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG0859 KOG Synaptobrevin/VAMP-like protein JGI ISS
PTHR21136Panther SNARE PROTEINS JGI ISS
PTHR21136:SF46Panther SUBFAMILY NOT NAMED JGI ISS
PF00957PFAM Synaptobrevin JGI ISS
UniRef100_D7KE74UniRef Annotation by Michelle Graham. Most informative UniRef hit: Vesicle-associated membrane protein 7B n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KE74_ARALL SoyBaseE_val: 3.00E-130ISS
UniRef100_UPI000233DD1FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DD1F related cluster n=1 Tax=unknown RepID=UPI000233DD1F SoyBaseE_val: 8.00E-164ISS

Expression Patterns of Glyma20g18860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g18860
ParalogEvidenceComments
Glyma10g24430 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g18860 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g076200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g18860
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g18860
>Glyma20g18860.1   sequence type=CDS   gene model=Glyma20g18860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGCAACAATCTTTGATTTATAGCTTTGTGGCTCGTGGGACCATGGTTCTTGCTGAGTACAGTGAGTTTTCTGGAAACTTCAACACCATTGCCTCTCAATGCCTCCAAAAGCTTCCTTCTTCCAACAACAGATTCACCTACAACTGTGATGGCCACACTTTCAATTATCTCGTTGAAAATGGATTCACCTACTGTGTGGTCGCTATTGAATCTGCTGGTAGACAACTTCCCATTGCTTTTCTAGAGCGTGTCAAGGATGAATTTAGCAAAAAATATGGTGGAGGCAAAGCTGCAACTGCTTCAGCAAACAGCCTAAACAGAGAATTTGGCCCAAAATTGAAGCAGCAAATGCAATATTGTGTTGATCATCCTGAAGAGATCAACAAGCTTGCCAAAGTGAAGGCTCAAGTTTCTGAAGTCAAGGGCGTTATGATGGAAAACATTGAAAAGGTTCTTGATCGTGGAGAAAAGATTGAGATGCTTGTGGATAAGACTGACAACCTTCGCTCACAGGCACAAGACTTTAGAACACAGGGCACAAAGGTGAAAAGGAAGATGTGGGTTCAAAATATGAAGATGAAATTGATTGTTTTTGGTATCGCCGTAGCATTAATTTTGATCATGTTTATGTCTATATGTCGTGGCTTCAGCTGCTTACATTAG
Predicted protein sequences of Glyma20g18860
>Glyma20g18860.1   sequence type=predicted peptide   gene model=Glyma20g18860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGQQSLIYSFVARGTMVLAEYSEFSGNFNTIASQCLQKLPSSNNRFTYNCDGHTFNYLVENGFTYCVVAIESAGRQLPIAFLERVKDEFSKKYGGGKAATASANSLNREFGPKLKQQMQYCVDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKVKRKMWVQNMKMKLIVFGIAVALILIMFMSICRGFSCLH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo